StarFunc result for job id Q16763

User Input

>input (222 residues)
MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLF
RMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLL
IHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASST
DPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16763	1.000	1.000	1.245E-41	222	1.000	1.000	Q16763.pdb.gz	UBE2S_HUMAN Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2
2	AFDB:Q9VX25	0.744	0.788	1.502E-26	209	0.577	0.612	Q9VX25.pdb.gz	UBE2S_DROME Ubiquitin-conjugating enzyme E2 S OS=Drosophila melanogaster OX=7227 GN=CG8188 PE=1 SV=2
3	AFDB:Q9FF66	0.740	0.658	2.604E-26	251	0.536	0.474	Q9FF66.pdb.gz	UBC22_ARATH Ubiquitin-conjugating enzyme E2 22 OS=Arabidopsis thaliana OX=3702 GN=UBC22 PE=1 SV=1
4	AFDB:P52478	0.605	0.694	2.218E-16	192	0.248	0.286	P52478.pdb.gz	UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans OX=6239 GN=ubc-1 PE=1 SV=1
5	AFDB:Q54F00	0.640	0.495	4.088E-16	292	0.248	0.188	Q54F00.pdb.gz	Q54F00_DICDI UBC core domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0291199 PE=3 SV=1
6	AFDB:Q9SLE4	0.599	0.884	1.023E-15	148	0.257	0.385	Q9SLE4.pdb.gz	UBC29_ARATH Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis thaliana OX=3702 GN=UBC29 PE=2 SV=1
7	PDB:3bzhA	0.624	0.844	1.403E-15	161	0.225	0.311	3bzhA.pdb.gz
8	AFDB:O13685	0.595	0.880	1.569E-15	148	0.270	0.405	O13685.pdb.gz	UBC13_SCHPO Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc13 PE=1 SV=1
9	PDB:2aakA	0.594	0.861	1.686E-15	150	0.221	0.327	2aakA.pdb.gz
10	AFDB:P25153	0.597	0.862	1.885E-15	151	0.212	0.311	P25153.pdb.gz	UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc6 PE=2 SV=2
11	AFDB:P49459	0.596	0.855	2.004E-15	152	0.225	0.329	P49459.pdb.gz	UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens OX=9606 GN=UBE2A PE=1 SV=2
12	AFDB:P52490	0.617	0.881	2.130E-15	153	0.279	0.405	P52490.pdb.gz	UBC13_YEAST Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC13 PE=1 SV=1
13	PDB:6cyrA	0.599	0.855	2.750E-15	153	0.225	0.327	6cyrA.pdb.gz
14	PDB:6zhtB	0.618	0.883	3.303E-15	153	0.270	0.392	6zhtB.pdb.gz
15	PDB:4ccgA	0.619	0.861	4.767E-15	157	0.216	0.306	4ccgA.pdb.gz	Structure of the Human Fancl Ring-Ube2T Complex Reveals Determinants of Cognate E3-E2 Selection.
16	PDB:3ptfA	0.606	0.863	7.774E-15	153	0.234	0.340	3ptfA.pdb.gz
17	PDB:5aieB	0.611	0.886	2.068E-14	150	0.248	0.367	5aieB.pdb.gz	Architecture of the Ubiquitylation Module of the Yeast Ccr4-not Complex.
18	PDB:4ii2C	0.594	0.867	2.337E-14	149	0.239	0.356	4ii2C.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
19	PDB:4x57C	0.605	0.887	4.578E-14	149	0.252	0.376	4x57C.pdb.gz
20	PDB:6d68A	0.603	0.832	5.173E-14	159	0.189	0.264	6d68A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16763	5.11e-162	448	222	1.000	1.000	UBE2S_HUMAN Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2
2	Q6NXQ4	5.75e-157	435	222	0.977	0.977	Q6NXQ4_HUMAN UBE2S protein OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=1
3	Q9VX25	1.63e-78	236	209	0.514	0.545	UBE2S_DROME Ubiquitin-conjugating enzyme E2 S OS=Drosophila melanogaster OX=7227 GN=CG8188 PE=1 SV=2
4	Q9FF66	1.11e-71	220	251	0.491	0.434	UBC22_ARATH Ubiquitin-conjugating enzyme E2 22 OS=Arabidopsis thaliana OX=3702 GN=UBC22 PE=1 SV=1
5	O13685	1.49e-36	127	148	0.270	0.405	UBC13_SCHPO Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc13 PE=1 SV=1
6	P52490	1.81e-35	124	153	0.288	0.418	UBC13_YEAST Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC13 PE=1 SV=1
7	P35133	4.52e-33	118	148	0.252	0.378	UBC10_ARATH Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana OX=3702 GN=UBC10 PE=1 SV=1
8	Q84K93	4.67e-33	118	148	0.257	0.385	Q84K93_GOSHI Ubiquitin-conjugating enzyme E2 OS=Gossypium hirsutum OX=3635 GN=UBC2 PE=2 SV=1
9	P35134	1.03e-32	117	148	0.248	0.372	UBC11_ARATH Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana OX=3702 GN=UBC11 PE=1 SV=2
10	P35131	1.27e-32	117	148	0.252	0.378	UBC8_ARATH Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana OX=3702 GN=UBC8 PE=1 SV=1
11	Q8S920	1.44e-32	117	147	0.252	0.381	UBC5A_ORYSJ Ubiquitin-conjugating enzyme E2 5A OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5A PE=2 SV=1
12	Q9SLE4	1.47e-32	117	148	0.257	0.385	UBC29_ARATH Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis thaliana OX=3702 GN=UBC29 PE=2 SV=1
13	Q94A97	4.18e-32	116	153	0.266	0.386	UBC35_ARATH Ubiquitin-conjugating enzyme E2 35 OS=Arabidopsis thaliana OX=3702 GN=UBC35 PE=1 SV=1
14	P63146	4.48e-32	115	152	0.230	0.336	UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens OX=9606 GN=UBE2B PE=1 SV=1
15	P63147	4.48e-32	115	152	0.230	0.336	UBE2B_MOUSE Ubiquitin-conjugating enzyme E2 B OS=Mus musculus OX=10090 GN=Ube2b PE=1 SV=1
16	P63149	4.48e-32	115	152	0.230	0.336	UBE2B_RAT Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus OX=10116 GN=Ube2b PE=2 SV=1
17	P62837	6.72e-32	115	147	0.243	0.367	UB2D2_HUMAN Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens OX=9606 GN=UBE2D2 PE=1 SV=1
18	P62838	6.72e-32	115	147	0.243	0.367	UB2D2_MOUSE Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus OX=10090 GN=Ube2d2 PE=1 SV=1
19	P62839	6.72e-32	115	147	0.243	0.367	UB2D2_RAT Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norvegicus OX=10116 GN=Ube2d2 PE=1 SV=1
20	Q8S919	8.87e-32	115	148	0.243	0.365	UBC5B_ORYSJ Ubiquitin-conjugating enzyme E2 5B OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5B PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03752 ALF	41	15.6	Short repeats of unknown function
2	PF00179 UQ_con	9.2e-37	137.3	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264552

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349957	0.999	Anaphase promoting complex subunit 11
2	9606.ENSP00000338413	0.997	Ubiquitin-like modifier-activating enzyme 1
3	9606.ENSP00000361540	0.996	Cell division cycle protein 20 homolog
4	9606.ENSP00000441543	0.994	Polyubiquitin-C
5	9606.ENSP00000434614	0.993	Cell division cycle protein 27 homolog
6	9606.ENSP00000304697	0.983	Polyubiquitin-B
7	9606.ENSP00000378350	0.983	Cell division cycle protein 23 homolog
8	9606.ENSP00000348838	0.981	Ubiquitin-conjugating enzyme E2 C
9	9606.ENSP00000340305	0.979	Ubiquitin-conjugating enzyme E2 variant 1
10	9606.ENSP00000314004	0.978	Anaphase-promoting complex subunit 2
11	9606.ENSP00000313454	0.969	Ubiquitin-like modifier-activating enzyme 6
12	9606.ENSP00000478501	0.968	Anaphase-promoting complex subunit 10
13	9606.ENSP00000428209	0.967	Ubiquitin-conjugating enzyme E2 variant 2
14	9606.ENSP00000353549	0.961	Cell division cycle protein 16 homolog
15	9606.ENSP00000261819	0.960	Anaphase-promoting complex subunit 5
16	9606.ENSP00000333266	0.957	Ubiquitin-like modifier-activating enzyme 7
17	9606.ENSP00000426654	0.957	Anaphase-promoting complex subunit 4
18	9606.ENSP00000378529	0.956	Fizzy-related protein homolog
19	9606.ENSP00000383719	0.956	Ubiquitin-conjugating enzyme E2 J2
20	9606.ENSP00000363787	0.952	E3 ubiquitin-protein ligase RING1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061631	0.998	ubiquitin conjugating enzyme activity
GO:0019899	0.431	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044260	0.987	cellular macromolecule metabolic process
GO:0006508	0.986	proteolysis
GO:0006511	0.979	ubiquitin-dependent protein catabolic process
GO:0065007	0.971	biological regulation
GO:0050789	0.942	regulation of biological process
GO:0032446	0.930	protein modification by small protein conjugation
GO:0000209	0.917	protein polyubiquitination
GO:0031396	0.886	regulation of protein ubiquitination
GO:0050794	0.855	regulation of cellular process
GO:0043161	0.842	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0048518	0.822	positive regulation of biological process
GO:0071840	0.797	cellular component organization or biogenesis
GO:0065009	0.693	regulation of molecular function
GO:0051173	0.681	positive regulation of nitrogen compound metabolic process
GO:0016043	0.651	cellular component organization
GO:0010604	0.634	positive regulation of macromolecule metabolic process
GO:0051247	0.530	positive regulation of protein metabolic process
GO:0050896	0.458	response to stimulus
GO:0048522	0.358	positive regulation of cellular process
GO:1903322	0.334	positive regulation of protein modification by small protein conjugation or removal
GO:0051716	0.329	cellular response to stimulus
GO:0048519	0.329	negative regulation of biological process
GO:0031398	0.313	positive regulation of protein ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0032991	0.997	protein-containing complex
GO:0140513	0.958	nuclear protein-containing complex
GO:0000151	0.933	ubiquitin ligase complex
GO:0000152	0.807	nuclear ubiquitin ligase complex
GO:0031461	0.797	cullin-RING ubiquitin ligase complex
GO:0005680	0.667	anaphase-promoting complex
GO:0016020	0.636	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.2.23	0.998	E2 ubiquitin-conjugating enzyme.

[back to server]