StarFunc result for job id Q16787

User Input

>input (1400 residues)
MAAAARPRGRALGPVLPPTPLLLLVLRVLPACGATARDPGAAAGLSLHPTYFNLAEAARI
WATATCGERGPGEGRPQPELYCKLVGGPTAPGSGHTIQGQFCDYCNSEDPRKAHPVTNAI
DGSERWWQSPPLSSGTQYNRVNLTLDLGQLFHVAYILIKFANSPRPDLWVLERSVDFGST
YSPWQYFAHSKVDCLKEFGREANMAVTRDDDVLCVTEYSRIVPLENGEVVVSLINGRPGA
KNFTFSHTLREFTKATNIRLRFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIGGQCV
CNGHAEVCNINNPEKLFRCECQHHTCGETCDRCCTGYNQRRWRPAAWEQSHECEACNCHG
HASNCYYDPDVERQQASLNTQGIYAGGGVCINCQHNTAGVNCEQCAKGYYRPYGVPVDAP
DGCIPCSCDPEHADGCEQGSGRCHCKPNFHGDNCEKCAIGYYNFPFCLRIPIFPVSTPSS
EDPVAGDIKGCDCNLEGVLPEICDAHGRCLCRPGVEGPRCDTCRSGFYSFPICQACWCSA
LGSYQMPCSSVTGQCECRPGVTGQRCDRCLSGAYDFPHCQGSSSACDPAGTINSNLGYCQ
CKLHVEGPTCSRCKLLYWNLDKENPSGCSECKCHKAGTVSGTGECRQGDGDCHCKSHVGG
DSCDTCEDGYFALEKSNYFGCQGCQCDIGGALSSMCSGPSGVCQCREHVVGKVCQRPENN
YYFPDLHHMKYEIEDGSTPNGRDLRFGFDPLAFPEFSWRGYAQMTSVQNDVRITLNVGKS
SGSLFRVILRYVNPGTEAVSGHITIYPSWGAAQSKEIIFLPSKEPAFVTVPGNGFADPFS
ITPGIWVACIKAEGVLLDYLVLLPRDYYEASVLQLPVTEPCAYAGPPQENCLLYQHLPVT
RFPCTLACEARHFLLDGEPRPVAVRQPTPAHPVMVDLSGREVELHLRLRIPQVGHYVVVV
EYSTEAAQLFVVDVNVKSSGSVLAGQVNIYSCNYSVLCRSAVIDHMSRIAMYELLADADI
QLKGHMARFLLHQVCIIPIEEFSAEYVRPQVHCIASYGRFVNQSATCVSLAHETPPTALI
LDVLSGRPFPHLPQQSSPSVDVLPGVTLKAPQNQVTLRGRVPHLGRYVFVIHFYQAAHPT
FPAQVSVDGGWPRAGSFHASFCPHVLGCRDQVIAEGQIEFDISEPEVAATVKVPEGKSLV
LVRVLVVPAENYDYQILHKKSMDKSLEFITNCGKNSFYLDPQTASRFCKNSARSLVAFYH
KGALPCECHPTGATGPHCSPEGGQCPCQPNVIGRQCTRCATGHYGFPRCKPCSCGRRLCE
EMTGQCRCPPRTVRPQCEVCETHSFSFHPMAGCEGCNCSRRGTIEAAMPECDRDSGQCRC
KPRITGRQCDRCASGFYRFP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61292	0.246	0.193	2.501E-63	1799	0.201	0.157	Q61292.pdb.gz	LAMB2_MOUSE Laminin subunit beta-2 OS=Mus musculus OX=10090 GN=Lamb2 PE=1 SV=2
2	AFDB:D3ZQN7	0.247	0.195	9.168E-63	1786	0.205	0.161	D3ZQN7.pdb.gz	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
3	AFDB:B7ZDA6	0.245	0.194	1.367E-61	1782	0.200	0.157	B7ZDA6.pdb.gz	B7ZDA6_DANRE Laminin subunit beta-2 precursor OS=Danio rerio OX=7955 GN=si:dkey-32e6.2 PE=1 SV=1
4	AFDB:P11046	0.242	0.191	3.138E-61	1788	0.213	0.167	P11046.pdb.gz	LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=LanB1 PE=1 SV=4
5	AFDB:A0A0R4IDN1	0.244	0.193	2.037E-60	1785	0.194	0.152	A0A0R4IDN1.pdb.gz
6	AFDB:O44565	0.239	0.189	1.057E-58	1790	0.192	0.150	O44565.pdb.gz	O44565_CAEEL Laminin subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=lam-1 PE=1 SV=3
7	AFDB:P55268	0.240	0.189	1.687E-58	1798	0.196	0.152	P55268.pdb.gz	LAMB2_HUMAN Laminin subunit beta-2 OS=Homo sapiens OX=9606 GN=LAMB2 PE=1 SV=2
8	AFDB:Q1LVF0	0.230	0.202	5.679E-56	1593	0.205	0.180	Q1LVF0.pdb.gz	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
9	AFDB:P15215	0.228	0.196	2.562E-55	1639	0.192	0.164	P15215.pdb.gz	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
10	AFDB:Q9Y6N6	0.235	0.210	8.465E-55	1575	0.198	0.176	Q9Y6N6.pdb.gz	LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens OX=9606 GN=LAMC3 PE=1 SV=3
11	PDB:6vlsD	0.066	0.087	2.544E-7	963	0.036	0.053	6vlsD.pdb.gz
12	PDB:5eiyB	0.062	0.120	1.930E-6	658	0.031	0.067	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
13	PDB:7ufgA	0.072	0.083	2.219E-5	1151	0.052	0.063	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
14	PDB:4zelA	0.060	0.127	2.593E-5	550	0.039	0.100	4zelA.pdb.gz	The crystal structure of human dopamine beta-hydroxylase at 2.9 angstrom resolution.
15	PDB:1ihmB	0.053	0.104	2.731E-5	511	0.044	0.121	1ihmB.pdb.gz
16	PDB:2vqaA	0.045	0.136	2.731E-5	356	0.034	0.135	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.
17	PDB:7l2zF	0.050	0.094	5.955E-5	664	0.036	0.077	7l2zF.pdb.gz
18	PDB:6l4cB	0.047	0.130	1.232E-4	373	0.028	0.105	6l4cB.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
19	PDB:1o59A	0.075	0.262	2.422E-4	318	0.026	0.113	1o59A.pdb.gz
20	PDB:1fxzA	0.045	0.121	3.140E-4	371	0.023	0.086	1fxzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MSA0	0.0	2949	3277	1.000	0.427	A0A0A0MSA0_HUMAN Laminin subunit alpha-3 OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=1
2	A0A1B0GWM3	0.0	2317	3333	0.775	0.326	A0A1B0GWM3_RAT Laminin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Lama3 PE=4 SV=2
3	A0A3B3ITG1	0.0	776	2198	0.260	0.166	A0A3B3ITG1_HUMAN Laminin subunit alpha 3 (Fragment) OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=1
4	A0A8I6A4V6	0.0	1213	3699	0.486	0.184	A0A8I6A4V6_RAT Laminin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Lama5 PE=1 SV=1
5	F1MAN8	0.0	1235	3713	0.491	0.185	F1MAN8_RAT Laminin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Lama5 PE=1 SV=2
6	O15230	0.0	1217	3695	0.479	0.181	LAMA5_HUMAN Laminin subunit alpha-5 OS=Homo sapiens OX=9606 GN=LAMA5 PE=1 SV=8
7	Q00174	0.0	608	3712	0.286	0.108	LAMA_DROME Laminin subunit alpha OS=Drosophila melanogaster OX=7227 GN=LanA PE=1 SV=2
8	Q16787	0.0	2950	3333	1.000	0.420	LAMA3_HUMAN Laminin subunit alpha-3 OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=3
9	Q2Q1W5	0.0	1328	3664	0.496	0.189	Q2Q1W5_DANRE Laminin alpha 5 OS=Danio rerio OX=7955 GN=wu:fb81a10 PE=1 SV=1
10	Q61001	0.0	1342	3718	0.507	0.191	LAMA5_MOUSE Laminin subunit alpha-5 OS=Mus musculus OX=10090 GN=Lama5 PE=1 SV=4
11	Q61789	0.0	2309	3330	0.769	0.323	LAMA3_MOUSE Laminin subunit alpha-3 OS=Mus musculus OX=10090 GN=Lama3 PE=1 SV=4
12	C1P641	6.56e-167	558	3663	0.260	0.099	C1P641_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
13	G5EEV6	5.86e-165	553	3704	0.261	0.099	G5EEV6_CAEEL Laminin alpha OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
14	Q21313	9.40e-165	552	3672	0.261	0.099	EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
15	C1P640	8.03e-164	549	3683	0.262	0.100	C1P640_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
16	P25391	6.65e-123	427	3075	0.169	0.077	LAMA1_HUMAN Laminin subunit alpha-1 OS=Homo sapiens OX=9606 GN=LAMA1 PE=1 SV=2
17	F1MMT2	7.60e-122	422	1964	0.171	0.122	F1MMT2_BOVIN Laminin subunit alpha 2 OS=Bos taurus OX=9913 GN=LAMA2 PE=4 SV=3
18	Q60675	7.97e-122	424	3118	0.166	0.075	LAMA2_MOUSE Laminin subunit alpha-2 OS=Mus musculus OX=10090 GN=Lama2 PE=1 SV=2
19	Q45H72	1.64e-121	422	3075	0.164	0.074	Q45H72_DANRE Laminin alpha 1 OS=Danio rerio OX=7955 GN=lama1 PE=1 SV=1
20	P24043	1.71e-121	422	3122	0.168	0.075	LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18436 HECW1_helix	5.2e+02	12.2	Helical box domain of E3 ubiquitin-protein ligase HECW1
2	PF00053 Laminin_EGF	3.6e-76	262.4	Laminin EGF domain
3	PF00055 Laminin_N	2.9e-68	241.4	Laminin N-terminal (Domain VI)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258341	0.987	Laminin subunit gamma-1
2	9606.ENSP00000354360	0.986	Laminin subunit gamma-3
3	9606.ENSP00000222399	0.984	Laminin subunit beta-1
4	9606.ENSP00000388325	0.980	Laminin subunit beta-2
5	9606.ENSP00000386896	0.978	Integrin alpha-6
6	9606.ENSP00000007722	0.976	Integrin alpha-3
7	9606.ENSP00000200181	0.972	Integrin beta-4
8	9606.ENSP00000442600	0.972	Dystroglycan
9	9606.ENSP00000375778	0.971	Laminin subunit beta-3
10	9606.ENSP00000264144	0.968	Laminin subunit gamma-2
11	9606.ENSP00000305714	0.967	Bone morphogenetic protein 1
12	9606.ENSP00000296585	0.947	Integrin alpha-2
13	9606.ENSP00000379350	0.946	Integrin beta-1
14	9606.ENSP00000282588	0.935	Integrin alpha-1
15	9606.ENSP00000307046	0.935	Syndecan-2
16	9606.ENSP00000260228	0.934	Matrix metalloproteinase-20
17	9606.ENSP00000308938	0.928	Plasminogen
18	9606.ENSP00000400365	0.925	Laminin subunit alpha-2
19	9606.ENSP00000374309	0.923	Laminin subunit alpha-1
20	9606.ENSP00000308208	0.921	Matrix metalloproteinase-14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0048856	0.976	anatomical structure development
GO:0032501	0.920	multicellular organismal process
GO:0007275	0.862	multicellular organism development
GO:0007492	0.856	endoderm development
GO:0001704	0.790	formation of primary germ layer
GO:0016043	0.765	cellular component organization
GO:0150115	0.743	cell-substrate junction organization
GO:0001706	0.688	endoderm formation
GO:0008544	0.642	epidermis development
GO:0007155	0.441	cell adhesion
GO:0030154	0.360	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0032991	0.982	protein-containing complex
GO:0043227	0.979	membrane-bounded organelle
GO:0043229	0.977	intracellular organelle
GO:0043231	0.971	intracellular membrane-bounded organelle
GO:0005576	0.959	extracellular region
GO:0031012	0.936	extracellular matrix
GO:0005737	0.930	cytoplasm
GO:0012505	0.919	endomembrane system
GO:0062023	0.905	collagen-containing extracellular matrix
GO:0005604	0.806	basement membrane
GO:0005615	0.736	extracellular space
GO:0005783	0.418	endoplasmic reticulum
GO:0043233	0.336	organelle lumen
GO:0031982	0.327	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]