StarFunc result for job id Q16795

User Input

>input (377 residues)
MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFG
ATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVV
QHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRY
LRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPV
YVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLLFHLVKYIFAVAHRLFLPFPLPLFAYRW
VARVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYR
WLSAEIEDVKPAKTVNI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16795	1.000	1.000	4.011E-76	377	1.000	1.000	Q16795.pdb.gz	NDUA9_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA9 PE=1 SV=2
2	AFDB:P34943	0.949	0.942	3.315E-68	380	0.790	0.784	P34943.pdb.gz	NDUA9_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Bos taurus OX=9913 GN=NDUFA9 PE=1 SV=1
3	AFDB:Q5BK63	0.939	0.939	2.588E-65	377	0.759	0.759	Q5BK63.pdb.gz	NDUA9_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ndufa9 PE=1 SV=2
4	PDB:7qskP	0.899	0.991	6.458E-60	342	0.727	0.801	7qskP.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
5	AFDB:A7MCD7	0.916	0.909	4.353E-59	380	0.615	0.611	A7MCD7.pdb.gz
6	PDB:7b93P	0.899	0.991	6.684E-57	342	0.719	0.792	7b93P.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
7	AFDB:Q5BJB8	0.657	0.801	4.675E-38	309	0.451	0.550	Q5BJB8.pdb.gz
8	AFDB:Q9SK66	0.817	0.767	6.199E-38	402	0.377	0.353	Q9SK66.pdb.gz	NDUA9_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g20360 PE=1 SV=2
9	PDB:6g72P	0.758	0.979	2.569E-37	291	0.637	0.825	6g72P.pdb.gz	Cryo-EM structures of complex I from mouse heart mitochondria in two biochemically defined states.
10	PDB:7aqrP	0.800	0.905	3.149E-34	332	0.345	0.392	7aqrP.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
11	AFDB:A0A1D8PJA6	0.822	0.803	4.732E-32	386	0.308	0.301	A0A1D8PJA6.pdb.gz	A0A1D8PJA6_CANAL NAD(P)-binding domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C301610WA PE=4 SV=1
12	AFDB:Q38CX2	0.781	0.789	4.898E-29	373	0.220	0.223	Q38CX2.pdb.gz	Q38CX2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2620 PE=4 SV=1
13	AFDB:Q388N6	0.673	0.530	5.429E-20	485	0.159	0.124	Q388N6.pdb.gz	Q388N6_TRYB2 3-beta hydroxysteroid dehydrogenase/isomerase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0070 PE=4 SV=1
14	AFDB:Q67ZE1	0.648	0.450	2.609E-15	564	0.186	0.124	Q67ZE1.pdb.gz	HSDD2_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2 OS=Arabidopsis thaliana OX=3702 GN=3BETAHSD/D2 PE=1 SV=2
15	PDB:4r1sA	0.569	0.665	1.718E-13	319	0.170	0.201	4r1sA.pdb.gz	Structural Studies of Cinnamoyl-CoA Reductase and Cinnamyl-Alcohol Dehydrogenase, Key Enzymes of Monolignol Biosynthesis.
16	PDB:1rpnD	0.569	0.656	1.046E-12	322	0.141	0.165	1rpnD.pdb.gz	Crystal structure of a tetrameric GDP-D-mannose 4,6-dehydratase from a bacterial GDP-D-rhamnose biosynthetic pathway.
17	PDB:6lttA	0.502	0.597	1.171E-12	311	0.178	0.215	6lttA.pdb.gz
18	PDB:2pk3A	0.563	0.676	1.467E-12	309	0.133	0.162	2pk3A.pdb.gz	The structural basis for catalytic function of GMD and RMD, two closely related enzymes from the GDP-D-rhamnose biosynthesis pathway.
19	PDB:6h0nA	0.553	0.553	4.287E-12	377	0.156	0.156	6h0nA.pdb.gz	Deciphering the enzymatic mechanism of sugar ring contraction in UDP-apiose biosynthesis.
20	PDB:5in4A	0.485	0.511	5.078E-12	355	0.106	0.113	5in4A.pdb.gz	Facile Modulation of Antibody Fucosylation with Small Molecule Fucostatin Inhibitors and Cocrystal Structure with GDP-Mannose 4,6-Dehydratase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P34943	0.0	637	380	0.790	0.784	NDUA9_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Bos taurus OX=9913 GN=NDUFA9 PE=1 SV=1
2	Q16795	0.0	775	377	1.000	1.000	NDUA9_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA9 PE=1 SV=2
3	Q5BK63	0.0	601	377	0.759	0.759	NDUA9_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ndufa9 PE=1 SV=2
4	Q9DC69	0.0	595	377	0.782	0.782	NDUA9_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Mus musculus OX=10090 GN=Ndufa9 PE=1 SV=2
5	A8E515	1.82e-179	505	380	0.605	0.600	A8E515_DANRE Ndufa9 protein OS=Danio rerio OX=7955 GN=ndufa9 PE=2 SV=1
6	F6NP87	2.12e-179	504	380	0.605	0.600	F6NP87_DANRE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Danio rerio OX=7955 GN=ndufa9 PE=1 SV=1
7	Q9SK66	3.59e-62	206	402	0.326	0.306	NDUA9_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g20360 PE=1 SV=2
8	A0A1D8PJA6	5.66e-56	190	386	0.321	0.313	A0A1D8PJA6_CANAL NAD(P)-binding domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C301610WA PE=4 SV=1
9	Q38CX2	2.84e-23	101	373	0.212	0.214	Q38CX2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2620 PE=4 SV=1
10	Q388N6	1.46e-08	58.5	485	0.180	0.140	Q388N6_TRYB2 3-beta hydroxysteroid dehydrogenase/isomerase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0070 PE=4 SV=1
11	P75822	0.001	43.1	476	0.138	0.109	YBJT_ECOLI Putative NAD(P)-binding protein YbjT OS=Escherichia coli (strain K12) OX=83333 GN=ybjT PE=3 SV=2
12	Q67ZE1	0.002	42.7	564	0.093	0.062	HSDD2_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2 OS=Arabidopsis thaliana OX=3702 GN=3BETAHSD/D2 PE=1 SV=2
13	A9X4U2	0.004	41.6	561	0.093	0.062	HSDD3_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 3 OS=Arabidopsis thaliana OX=3702 GN=3BETAHSD/D3 PE=2 SV=2
14	P9WH09	0.005	40.8	304	0.106	0.132	RMLD_MYCTU dTDP-4-dehydrorhamnose reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rmlD PE=1 SV=1
15	Q566U2	0.007	40.4	345	0.111	0.122	Q566U2_DANRE NAD(P) dependent steroid dehydrogenase-like OS=Danio rerio OX=7955 GN=zgc:112474 PE=1 SV=1
16	Q9SEV0	0.047	37.7	340	0.058	0.065	BAN_ARATH Anthocyanidin reductase OS=Arabidopsis thaliana OX=3702 GN=BAN PE=1 SV=2
17	P26150	0.093	37.0	373	0.178	0.180	3BHS3_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 3 OS=Mus musculus OX=10090 GN=Hsd3b3 PE=1 SV=3
18	P52580	0.13	36.2	309	0.069	0.084	IFRH_MAIZE Isoflavone reductase homolog IRL OS=Zea mays OX=4577 GN=IRL PE=1 SV=1
19	F1QSA2	0.15	36.2	374	0.178	0.179	F1QSA2_DANRE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 isoform X1 OS=Danio rerio OX=7955 GN=hsd3b1 PE=1 SV=1
20	Q62878	0.19	36.2	373	0.191	0.193	3BHS4_RAT 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4 OS=Rattus norvegicus OX=10116 GN=Hsd3b6 PE=2 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01073 3Beta_HSD	1e-06	39.6	3-beta hydroxysteroid dehydrogenase/isomerase family
2	PF00106 adh_short	5e+02	11.5	short chain dehydrogenase
3	PF01370 Epimerase	4.6e-07	41.1	NAD dependent epimerase/dehydratase family
4	PF16363 GDP_Man_Dehyd	2.5	19.1	GDP-mannose 4,6 dehydratase
5	PF13460 NAD_binding_10	0.00026	32.4	NAD(P)H-binding
6	PF07993 NAD_binding_4	0.72	20.6	Male sterility protein
7	PF05368 NmrA	8.4e-06	37.0	NmrA-like family
8	PF04321 RmlD_sub_bind	0.18	22.4	RmlD substrate binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000266544

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000184266	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
2	9606.ENSP00000215565	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
3	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
4	9606.ENSP00000237889	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
5	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
6	9606.ENSP00000252711	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
7	9606.ENSP00000259037	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
8	9606.ENSP00000263774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
9	9606.ENSP00000268379	0.999	Cytochrome b-c1 complex subunit 2, mitochondrial
10	9606.ENSP00000268668	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
11	9606.ENSP00000274137	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
12	9606.ENSP00000276062	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
13	9606.ENSP00000276689	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
14	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
15	9606.ENSP00000299166	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
16	9606.ENSP00000301457	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
17	9606.ENSP00000306397	0.999	Cytochrome b-c1 complex subunit Rieske, mitochondrial
18	9606.ENSP00000315774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
19	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
20	9606.ENSP00000327268	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016491	0.999	oxidoreductase activity
GO:0016651	0.587	oxidoreductase activity, acting on NAD(P)H
GO:0097159	0.536	organic cyclic compound binding
GO:1901363	0.535	heterocyclic compound binding
GO:0003954	0.335	NADH dehydrogenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.971	cellular process
GO:0071840	0.948	cellular component organization or biogenesis
GO:0016043	0.938	cellular component organization
GO:0033108	0.932	mitochondrial respiratory chain complex assembly
GO:0010257	0.927	NADH dehydrogenase complex assembly
GO:0032981	0.918	mitochondrial respiratory chain complex I assembly
GO:0008152	0.492	metabolic process
GO:0048511	0.480	rhythmic process
GO:0050896	0.335	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005747	0.999	mitochondrial respiratory chain complex I
GO:0070013	0.974	intracellular organelle lumen
GO:0005634	0.884	nucleus
GO:0005759	0.736	mitochondrial matrix
GO:0031981	0.376	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.999	Oxidoreductases.
EC:1.6.-.-	0.587	Acting on NADH or NADPH.
RHEA:11356	0.335	A + H(+) + NADH = AH2 + NAD(+)

[back to server]