StarFunc result for job id Q16799

User Input

>input (776 residues)
MAAPGDPQDELLPLAGPGSQWLRHRGEGENEAVTPKGATPAPQAGEPSPGLGARAREAAS
REAGSGPARQSPVAMETASTGVAGVSSAMDHTFSTTSKDGEGSCYTSLISDICYPPQEDS
TYFTGILQKENGHVTISESPEELGTPGPSLPDVPGIESRGLFSSDSGIEMTPAESTEVNK
ILADPLDQMKAEAYKYIDITRPEEVKHQEQHHPELEDKDLDFKNKDTDISIKPEGVREPD
KPAPVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTPVKITLTEIEPSVETTTQEKT
PEKQDICLKPSPDTVPTVTVSEPEDDSPGSITPPSSGTEPSAAESQGKGSISEDELITAI
KEAKGLSYETAENPRPVGQLADRPEVKARSGPPTIPSPLDHEASSAESGDSEIELVSEDP
MAAEDALPSGYVSFGHVGGPPPSPASPSIQYSILREEREAELDSELIIESCDASSASEES
PKREQDSPPMKPSALDAIREETGVRAEERAPSRRGLAEPGSFLDYPSTEPQPGPELPPGD
GALEPETPMLPRKPEEDSSSNQSPAATKGPGPLGPGAPPPLLFLNKQKAIDLLYWRDIKQ
TGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAY
LELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFN
GLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16799	1.000	1.000	1.527E-101	776	1.000	1.000	Q16799.pdb.gz	RTN1_HUMAN Reticulon-1 OS=Homo sapiens OX=9606 GN=RTN1 PE=1 SV=1
2	AFDB:Q8K0T0	0.431	0.429	3.101E-82	780	0.821	0.817	Q8K0T0.pdb.gz	RTN1_MOUSE Reticulon-1 OS=Mus musculus OX=10090 GN=Rtn1 PE=1 SV=1
3	AFDB:Q4G5U8	0.221	0.220	3.465E-18	780	0.237	0.236	Q4G5U8.pdb.gz
4	AFDB:Q9NQC3	0.133	0.091	4.462E-18	1192	0.298	0.194	Q9NQC3.pdb.gz	RTN4_HUMAN Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2
5	AFDB:Q9JK11	0.135	0.097	2.168E-17	1163	0.290	0.193	Q9JK11.pdb.gz	RTN4_RAT Reticulon-4 OS=Rattus norvegicus OX=10116 GN=Rtn4 PE=1 SV=1
6	AFDB:Q4G5U4	0.146	0.150	5.728E-13	753	0.226	0.232	Q4G5U4.pdb.gz
7	AFDB:Q4G5U2	0.111	0.124	6.242E-9	685	0.197	0.223	Q4G5U2.pdb.gz
8	AFDB:A2A870	0.054	0.039	3.751E-4	1173	0.178	0.118	A2A870.pdb.gz	FBF1_MOUSE Fas-binding factor 1 OS=Mus musculus OX=10090 GN=Fbf1 PE=1 SV=1
9	AFDB:Q6Y685	0.051	0.051	8.013E-4	774	0.161	0.161	Q6Y685.pdb.gz	TACC1_MOUSE Transforming acidic coiled-coil-containing protein 1 OS=Mus musculus OX=10090 GN=Tacc1 PE=1 SV=1
10	AFDB:Q9UPV0	0.050	0.032	1.508E-3	1460	0.147	0.078	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
11	PDB:7t55A	0.048	0.051	1.863	715	0.046	0.050	7t55A.pdb.gz	Structures of the peptidase-containing ABC transporter PCAT1 under equilibrium and nonequilibrium conditions.
12	PDB:6uxwA	0.057	0.057	3.978	778	0.046	0.046	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
13	PDB:6rw4O	0.029	0.080	7.029	194	0.018	0.072	6rw4O.pdb.gz	Distinct pre-initiation steps in human mitochondrial translation.
14	PDB:6gawAp	0.029	0.081	7.976	190	0.018	0.074	6gawAp.pdb.gz	Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
15	PDB:7vgfA	0.054	0.073	9.052	550	0.034	0.047	7vgfA.pdb.gz	Cryo-EM structure of AMP-PNP-bound human mitochondrial ATP-binding cassette transporter ABCB7.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16799	0.0	1559	776	1.000	1.000	RTN1_HUMAN Reticulon-1 OS=Homo sapiens OX=9606 GN=RTN1 PE=1 SV=1
2	Q2NKQ5	0.0	1411	702	0.905	1.000	Q2NKQ5_HUMAN Reticulon OS=Homo sapiens OX=9606 GN=RTN1 PE=1 SV=1
3	Q64548	0.0	1127	777	0.818	0.817	RTN1_RAT Reticulon-1 OS=Rattus norvegicus OX=10116 GN=Rtn1 PE=1 SV=1
4	Q8K0T0	0.0	1151	780	0.822	0.818	RTN1_MOUSE Reticulon-1 OS=Mus musculus OX=10090 GN=Rtn1 PE=1 SV=1
5	Q6IFY7	9.03e-103	316	207	0.209	0.783	RTN1A_XENLA Reticulon-1-A OS=Xenopus laevis OX=8355 GN=rtn1-a PE=2 SV=1
6	Q99P72	3.52e-86	298	1162	0.170	0.114	RTN4_MOUSE Reticulon-4 OS=Mus musculus OX=10090 GN=Rtn4 PE=1 SV=2
7	Q9NQC3	5.01e-85	295	1192	0.168	0.109	RTN4_HUMAN Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2
8	Q9JK11	2.00e-84	293	1163	0.166	0.111	RTN4_RAT Reticulon-4 OS=Rattus norvegicus OX=10116 GN=Rtn4 PE=1 SV=1
9	Q4G5V9	2.19e-79	255	212	0.148	0.542	Q4G5V9_DANRE Reticulon OS=Danio rerio OX=7955 GN=rtn4 PE=1 SV=1
10	F1QT89	2.70e-79	254	196	0.147	0.582	F1QT89_DANRE Reticulon OS=Danio rerio OX=7955 GN=Nogo-B PE=1 SV=1
11	Q4G5W2	1.95e-77	254	322	0.146	0.351	Q4G5W2_DANRE Reticulon OS=Danio rerio OX=7955 GN=rtn4 PE=1 SV=1
12	Q6RJR6	5.91e-72	255	940	0.144	0.119	RTN3_RAT Reticulon-3 OS=Rattus norvegicus OX=10116 GN=Rtn3 PE=1 SV=1
13	Q9ES97	1.18e-71	254	964	0.144	0.116	RTN3_MOUSE Reticulon-3 OS=Mus musculus OX=10090 GN=Rtn3 PE=1 SV=2
14	O95197	1.74e-71	255	1032	0.144	0.109	RTN3_HUMAN Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2
15	Q9VMW1	3.86e-66	221	224	0.130	0.451	Q9VMW1_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=2
16	Q9VMW2	4.16e-65	217	202	0.126	0.485	Q9VMW2_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=1
17	E1JHT9	7.95e-65	217	222	0.126	0.441	E1JHT9_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=2
18	Q9VMW4	7.95e-65	217	222	0.126	0.441	Q9VMW4_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=1
19	Q7KTP4	1.17e-64	217	234	0.126	0.419	Q7KTP4_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=1
20	E1JHT6	5.70e-63	224	607	0.128	0.163	E1JHT6_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02453 Reticulon	2.7e-40	149.4	Reticulon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267484

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368959	0.918	Receptor expression-enhancing protein 5
2	9606.ENSP00000480893	0.902	Spastin
3	9606.ENSP00000351155	0.811	Atlastin-1
4	9606.ENSP00000367590	0.758	Receptor expression-enhancing protein 2
5	9606.ENSP00000355777	0.755	Golgi resident protein GCP60
6	9606.ENSP00000337838	0.736	Reticulon-4
7	9606.ENSP00000020926	0.728	Synaptotagmin-13
8	9606.ENSP00000363397	0.720	Ceramide glucosyltransferase
9	9606.ENSP00000438346	0.712	Receptor expression-enhancing protein 1
10	9606.ENSP00000422473	0.706	Transmembrane protein 33
11	9606.ENSP00000381553	0.698	Cilia- and flagella-associated protein 53
12	9606.ENSP00000005257	0.687	Ras-related protein Ral-A
13	9606.ENSP00000357998	0.678	Translocation protein SEC63 homolog
14	9606.ENSP00000323527	0.672	Muskelin
15	9606.ENSP00000281821	0.662	Ephrin type-A receptor 4
16	9606.ENSP00000358698	0.661	Protein Wnt-2b
17	9606.ENSP00000043402	0.657	Reticulon-4 receptor
18	9606.ENSP00000272748	0.657	Endoplasmic reticulum junction formation protein lunapark
19	9606.ENSP00000278572	0.656	40S ribosomal protein S3
20	9606.ENSP00000233596	0.653	Receptor accessory protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.992	biological regulation
GO:0009987	0.991	cellular process
GO:0050789	0.984	regulation of biological process
GO:0048519	0.919	negative regulation of biological process
GO:0032501	0.852	multicellular organismal process
GO:0032502	0.760	developmental process
GO:0019222	0.720	regulation of metabolic process
GO:0080090	0.709	regulation of primary metabolic process
GO:0060255	0.707	regulation of macromolecule metabolic process
GO:0051171	0.707	regulation of nitrogen compound metabolic process
GO:0050794	0.675	regulation of cellular process
GO:1902991	0.638	regulation of amyloid precursor protein catabolic process
GO:0048856	0.599	anatomical structure development
GO:0007275	0.545	multicellular organism development
GO:0034248	0.505	regulation of amide metabolic process
GO:0048731	0.484	system development
GO:0071840	0.473	cellular component organization or biogenesis
GO:0007399	0.441	nervous system development
GO:0016043	0.415	cellular component organization
GO:0030154	0.408	cell differentiation
GO:0051248	0.339	negative regulation of protein metabolic process
GO:0030182	0.320	neuron differentiation
GO:1902003	0.314	regulation of amyloid-beta formation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0016020	0.943	membrane
GO:0031090	0.572	organelle membrane
GO:0031984	0.545	organelle subcompartment
GO:0000139	0.348	Golgi membrane
GO:0005789	0.333	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]