StarFunc result for job id Q16816

User Input

>input (387 residues)
MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFS
PEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKV
TLSEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGER
LREVCGTPSYLAPEIIECSMNEDHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLR
MIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFS
PRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVK
KGQQQNRAALFENTPKAVLLSLAEEDY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07934	0.767	0.765	3.105E-66	388	0.935	0.933	P07934.pdb.gz	PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus OX=10090 GN=Phkg1 PE=1 SV=3
2	AFDB:A0JME5	0.745	0.732	4.191E-56	394	0.736	0.723	A0JME5.pdb.gz	A0JME5_DANRE phosphorylase kinase OS=Danio rerio OX=7955 GN=zgc:153009 PE=2 SV=1
3	AFDB:J3KNN3	0.730	0.690	4.125E-51	410	0.625	0.590	J3KNN3.pdb.gz	J3KNN3_HUMAN phosphorylase kinase OS=Homo sapiens OX=9606 GN=PHKG2 PE=1 SV=1
4	AFDB:X2JEJ4	0.731	0.724	9.290E-49	391	0.550	0.545	X2JEJ4.pdb.gz	X2JEJ4_DROME phosphorylase kinase OS=Drosophila melanogaster OX=7227 GN=PhKgamma PE=3 SV=1
5	AFDB:Q961E7	0.705	0.652	1.979E-46	419	0.556	0.513	Q961E7.pdb.gz	Q961E7_DROME phosphorylase kinase OS=Drosophila melanogaster OX=7227 GN=PhKgamma PE=2 SV=1
6	AFDB:Q9I7D0	0.715	0.499	2.815E-42	560	0.558	0.386	Q9I7D0.pdb.gz	Q9I7D0_DROME phosphorylase kinase OS=Drosophila melanogaster OX=7227 GN=PhKgamma PE=2 SV=3
7	AFDB:Q8BWQ5	0.656	0.329	2.832E-30	790	0.284	0.139	Q8BWQ5.pdb.gz	DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus OX=10090 GN=Dclk3 PE=1 SV=2
8	AFDB:Q00168	0.637	0.471	1.357E-28	530	0.297	0.217	Q00168.pdb.gz	KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster OX=7227 GN=CaMKII PE=1 SV=1
9	AFDB:Q57VI9	0.647	0.463	2.231E-28	545	0.269	0.191	Q57VI9.pdb.gz	Q57VI9_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.2F2.540 PE=4 SV=1
10	AFDB:F1QW17	0.636	0.424	2.783E-28	587	0.307	0.203	F1QW17.pdb.gz	F1QW17_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2g2 PE=1 SV=3
11	PDB:5u6yA	0.632	0.536	2.672E-27	459	0.274	0.231	5u6yA.pdb.gz
12	PDB:2yaaA	0.656	0.838	1.353E-25	300	0.279	0.360	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
13	PDB:7myjC	0.624	0.523	2.828E-24	465	0.287	0.239	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
14	PDB:4zhxA	0.625	0.593	3.159E-24	409	0.258	0.244	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
15	PDB:6b1uA	0.631	0.554	3.729E-24	442	0.269	0.235	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
16	PDB:3soaA	0.625	0.558	6.132E-24	436	0.269	0.239	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
17	PDB:4rerA	0.620	0.526	1.569E-23	459	0.287	0.242	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:6byrA	0.630	0.603	2.581E-23	405	0.238	0.227	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
19	PDB:5x3fB	0.608	0.671	4.740E-23	349	0.227	0.252	5x3fB.pdb.gz
20	PDB:5ufuA	0.624	0.653	5.295E-23	369	0.243	0.255	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JME5	0.0	622	394	0.739	0.726	A0JME5_DANRE phosphorylase kinase OS=Danio rerio OX=7955 GN=zgc:153009 PE=2 SV=1
2	J3KNN3	0.0	522	410	0.620	0.585	J3KNN3_HUMAN phosphorylase kinase OS=Homo sapiens OX=9606 GN=PHKG2 PE=1 SV=1
3	P00518	0.0	768	387	0.943	0.943	PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus OX=9986 GN=PHKG1 PE=1 SV=2
4	P07934	0.0	762	388	0.933	0.930	PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus OX=10090 GN=Phkg1 PE=1 SV=3
5	P13286	0.0	766	388	0.938	0.936	PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus OX=10116 GN=Phkg1 PE=2 SV=2
6	P15735	0.0	529	406	0.620	0.591	PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens OX=9606 GN=PHKG2 PE=1 SV=1
7	P31325	0.0	523	406	0.610	0.581	PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus OX=10116 GN=Phkg2 PE=1 SV=1
8	Q16816	0.0	807	387	1.000	1.000	PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens OX=9606 GN=PHKG1 PE=2 SV=3
9	Q9DB30	0.0	523	406	0.610	0.581	PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus OX=10090 GN=Phkg2 PE=2 SV=2
10	X2JEJ4	7.22e-151	433	391	0.548	0.542	X2JEJ4_DROME phosphorylase kinase OS=Drosophila melanogaster OX=7227 GN=PhKgamma PE=3 SV=1
11	Q961E7	1.01e-146	424	419	0.548	0.506	Q961E7_DROME phosphorylase kinase OS=Drosophila melanogaster OX=7227 GN=PhKgamma PE=2 SV=1
12	Q9I7D0	8.28e-121	363	560	0.442	0.305	Q9I7D0_DROME phosphorylase kinase OS=Drosophila melanogaster OX=7227 GN=PhKgamma PE=2 SV=3
13	Q9VYV7	2.13e-117	354	560	0.432	0.298	Q9VYV7_DROME phosphorylase kinase OS=Drosophila melanogaster OX=7227 GN=PhKgamma PE=4 SV=2
14	Q4V9P8	7.64e-63	213	560	0.313	0.216	Q4V9P8_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2ga PE=1 SV=1
15	P25323	1.02e-62	205	295	0.297	0.390	MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum OX=44689 GN=mlkA PE=1 SV=2
16	F1QW17	2.04e-62	212	587	0.313	0.206	F1QW17_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2g2 PE=1 SV=3
17	Q13557	4.13e-62	209	499	0.310	0.240	KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D PE=1 SV=3
18	Q6PHZ2	4.13e-62	209	499	0.310	0.240	KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus OX=10090 GN=Camk2d PE=1 SV=1
19	E9QDQ2	5.30e-62	209	531	0.302	0.220	E9QDQ2_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=CAMK2Gb PE=1 SV=2
20	P15791	9.44e-62	209	533	0.310	0.225	KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus OX=10116 GN=Camk2d PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	3.4	18.3	ABC1 atypical kinase-like domain
2	PF01636 APH	0.2	23.0	Phosphotransferase enzyme family
3	PF01633 Choline_kinase	79	14.3	Choline/ethanolamine kinase
4	PF11300 DUF3102	5.2e+02	12.3	Protein of unknown function (DUF3102)
5	PF13095 FTA2	3.7	18.7	Kinetochore Sim4 complex subunit FTA2
6	PF12330 Haspin_kinase	0.017	25.7	Haspin like kinase domain
7	PF06293 Kdo	0.014	26.3	Lipopolysaccharide kinase (Kdo/WaaP) family
8	PF14531 Kinase-like	0.0086	27.0	Kinase-like
9	PF00069 Pkinase	2.6e-71	251.7	Protein kinase domain
10	PF17667 Pkinase_fungal	21	15.4	Fungal protein kinase
11	PF07714 PK_Tyr_Ser-Thr	3.7e-26	103.6	Protein tyrosine and serine/threonine kinase
12	PF01163 RIO1	9.4	17.3	RIO1 family
13	PF18520 Spc110_C	1.4	19.9	Spindle pole body component 110 C-terminal domain
14	PF19974 TCAD9	2.7e+02	12.0	Ternary complex associated domain 9
15	PF10707 YrbL-PhoP_reg	8.2	17.5	PhoP regulatory network protein YrbL

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000032825

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000013809	0.985	Phosphorylase b kinase regulatory subunit
2	9598.ENSPTRP00000019197	0.947	Calmodulin 1 (Phosphorylase kinase, delta)
3	9598.ENSPTRP00000006629	0.930	Alpha-1,4 glucan phosphorylase
4	9598.ENSPTRP00000037217	0.916	Phosphorylase b kinase regulatory subunit
5	9598.ENSPTRP00000037880	0.902	Phosphorylase b kinase regulatory subunit
6	9598.ENSPTRP00000010744	0.899	Alpha-1,4 glucan phosphorylase
7	9598.ENSPTRP00000003820	0.862	Uncharacterized protein
8	9598.ENSPTRP00000003821	0.862	Belongs to the calmodulin family.
9	9598.ENSPTRP00000043977	0.862	Calmodulin-like 6
10	9598.ENSPTRP00000013693	0.829	Phosphorylase kinase, gamma 2 (Testis)
11	9598.ENSPTRP00000020427	0.748	Pan troglodytes calmodulin 2 (phosphorylase kinase, delta) (CALM2), mRNA
12	9598.ENSPTRP00000043284	0.748	Pan troglodytes calmodulin 1 (phosphorylase kinase, delta) (CALM1), mRNA
13	9598.ENSPTRP00000034207	0.683	Protein phosphatase 1 regulatory subunit 3
14	9598.ENSPTRP00000033571	0.680	Protein phosphatase 1, regulatory subunit 3A
15	9598.ENSPTRP00000035898	0.652	Belongs to the protein kinase superfamily.
16	9598.ENSPTRP00000009251	0.649	Protein phosphatase 1, catalytic subunit, alpha isozyme
17	9598.ENSPTRP00000042330	0.648	Belongs to the protein kinase superfamily.
18	9598.ENSPTRP00000018062	0.646	Belongs to the protein kinase superfamily.
19	9598.ENSPTRP00000009252	0.617	Belongs to the PPP phosphatase family.
20	9598.ENSPTRP00000020246	0.616	Belongs to the PPP phosphatase family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004683	0.999	calmodulin-dependent protein kinase activity
GO:0043167	0.769	ion binding
GO:1901363	0.461	heterocyclic compound binding
GO:0097159	0.450	organic cyclic compound binding
GO:0032559	0.419	adenyl ribonucleotide binding
GO:0043168	0.412	anion binding
GO:0035639	0.400	purine ribonucleoside triphosphate binding
GO:0005524	0.375	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0005977	0.956	glycogen metabolic process
GO:1901564	0.841	organonitrogen compound metabolic process
GO:0006796	0.774	phosphate-containing compound metabolic process
GO:0016310	0.682	phosphorylation
GO:0019538	0.442	protein metabolic process
GO:0043412	0.394	macromolecule modification
GO:0036211	0.362	protein modification process
GO:0050789	0.319	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0032991	0.983	protein-containing complex
GO:0043226	0.913	organelle
GO:0043229	0.899	intracellular organelle
GO:1902494	0.847	catalytic complex
GO:0043227	0.691	membrane-bounded organelle
GO:0043231	0.677	intracellular membrane-bounded organelle
GO:0043228	0.645	non-membrane-bounded organelle
GO:0043232	0.636	intracellular non-membrane-bounded organelle
GO:1990234	0.463	transferase complex
GO:0061695	0.443	transferase complex, transferring phosphorus-containing groups
GO:1902911	0.431	protein kinase complex
GO:1902554	0.370	serine/threonine protein kinase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.17	0.999	calcium/calmodulin-dependent protein kinase.

[back to server]