StarFunc result for job id Q16821

User Input

>input (1122 residues)
MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSEDIYLDTPSSG
TRRVSFADSFGFNLVSVKEFDCWELPSASTTFDLGTDIFHTEEYVLAPLFDLPSSKEDLM
QQLQIQKAILESTESLLGSTSIKGIIRVLNVSFEKLVYVRMSLDDWQTHYDILAEYVPNS
CDGETDQFSFKIVLVPPYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTFICQKKEQEPEP
VKPWKEVPNRQIKGCLKVKSSKEESSVTSEENNFENPKNTDTYIPTIICSHEDKEDLEAS
NRNVKDVNREHDEHNEKELELMINQHLIRTRSTASRDERNTFSTDPVNFPNKAEGLEKKQ
IHGEICTDLFQRSLSPSSSAESSVKGDFYCNEKYSSGDDCTHQPSEETTSNMGEIKPSLG
DTSSDELVQLHTGSKEVLDDNANPAHGNGTVQIPCPSSDQLMAGNLNKKHEGGAKNIEVK
DLGCLRRDFHSDTSACLKESTEEGSSKEDYYGNGKDDEEQRIYLGVNEKQRKNFQTILHD
QERKMGNPKISVAGIGASNRDLATLLSEHTAIPTRAITADVSHSPRTNLSWEEAVLTPEH
HHLTSEGSALGGITGQVCSSRTGNVLRNDYLFQVEEKSGGINSEDQDNSPQHKQSWNVLE
SQGKSRENKTNITEHIKGQTDCEDVWGKRDNTRSLKATTEELFTCQETVCCELSSLADHG
ITEKAEAGTAYIIKTTSESTPESMSAREKAIIAKLPQETARSDRPIEVKETAFDPHEGRN
DDSHYTLCQRDTVGVIYDNDFEKESRLGICNVRVDEMEKEETMSMYNPRKTHDREKCGTG
NITSVEESSWVITEYQKATSKLDLQLGMLPTDKTVFSENRDLRQVQELSKKTDSDAIVHS
AFNSDTNRAPQNSSPFSKHHTEISVSTNEQAIAVENAVTTMASQPISTKSENICNSTREI
QGIEKHPYPESKPEEVSRSSGIVTSGSRKERCIGQIFQTEEYSVEKSLGPMILINKPLEN
MEEARHENEGLVSSGQSLYTSGEKESDSSASTSLPVEESQAQGNESLFSKYTNSKIPYFL
LFLIFLITVYHYDLMIGLTFYVLSLSWLSWEEGRQKESVKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q00756	0.267	0.269	5.317E-98	1109	0.719	0.728	Q00756.pdb.gz	PPR3A_RABIT Protein phosphatase 1 regulatory subunit 3A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R3A PE=1 SV=1
2	AFDB:Q99MR9	0.202	0.206	2.034E-79	1089	0.616	0.635	Q99MR9.pdb.gz	PPR3A_MOUSE Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp1r3a PE=1 SV=2
3	AFDB:D3ZGB1	0.051	0.039	5.473E-5	1548	0.136	0.099	D3ZGB1.pdb.gz	NFAT5_RAT Nuclear factor of activated T-cells 5 OS=Rattus norvegicus OX=10116 GN=Nfat5 PE=1 SV=1
4	AFDB:Q3TUF7	0.053	0.046	2.687E-4	1407	0.125	0.100	Q3TUF7.pdb.gz	YETS2_MOUSE YEATS domain-containing protein 2 OS=Mus musculus OX=10090 GN=Yeats2 PE=1 SV=2
5	AFDB:Q9ULM3	0.054	0.048	4.743E-4	1422	0.119	0.094	Q9ULM3.pdb.gz	YETS2_HUMAN YEATS domain-containing protein 2 OS=Homo sapiens OX=9606 GN=YEATS2 PE=1 SV=2
6	PDB:1j0hA	0.064	0.114	1.418E-3	588	0.013	0.026	1j0hA.pdb.gz	Three-dimensional Structure and Substrate Binding of Bacillus stearothermophilus Neopullulanase
7	PDB:1ea9C	0.064	0.119	2.650E-3	583	0.018	0.034	1ea9C.pdb.gz
8	PDB:2ag2A	0.070	0.296	2.969E-3	164	0.012	0.079	2ag2A.pdb.gz	Crystal Structure Analysis of Phosphatidylcholine-GM2-Activator Product Complexes: Evidence for Hydrolase Activity.
9	AFDB:P32790	0.044	0.041	3.274E-3	1244	0.114	0.103	P32790.pdb.gz	SLA1_YEAST Actin cytoskeleton-regulatory complex protein SLA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLA1 PE=1 SV=1
10	PDB:1ogpA	0.066	0.161	4.678E-3	388	0.018	0.052	1ogpA.pdb.gz	The Crystal Structure of Plant Sulfite Oxidase Provides Insights Into Sulfite Oxidation in Plants and Animals
11	AFDB:B4UN32	0.037	0.035	4.873E-3	1208	0.137	0.127	B4UN32.pdb.gz	AWP3B_CANGA Adhesin AWP3b OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP3b PE=1 SV=2
12	AFDB:Q5RHP9	0.051	0.042	6.475E-3	1530	0.154	0.113	Q5RHP9.pdb.gz	ERIC3_HUMAN Glutamate-rich protein 3 OS=Homo sapiens OX=9606 GN=ERICH3 PE=1 SV=1
13	PDB:5kwyC	0.070	0.411	6.578E-3	133	0.011	0.090	5kwyC.pdb.gz	Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
14	PDB:2hkaB	0.066	0.387	6.963E-3	130	0.010	0.085	2hkaB.pdb.gz	Structural Basis of Sterol Binding by NPC2, a Lysosomal Protein Deficient in Niemann-Pick Type C2 Disease
15	AFDB:Q9VID5	0.049	0.052	7.678E-3	1039	0.110	0.118	Q9VID5.pdb.gz	Q9VID5_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8671 PE=3 SV=2
16	PDB:1yycA	0.069	0.308	9.250E-3	174	0.008	0.052	1yycA.pdb.gz
17	PDB:7vt9A	0.061	0.108	1.229E-2	604	0.006	0.012	7vt9A.pdb.gz
18	PDB:6b2eB	0.052	0.209	1.543E-2	193	0.012	0.067	6b2eB.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
19	AFDB:Q62656	0.072	0.038	1.607E-2	2316	0.128	0.062	Q62656.pdb.gz	PTPRZ_RAT Receptor-type tyrosine-protein phosphatase zeta OS=Rattus norvegicus OX=10116 GN=Ptprz1 PE=1 SV=1
20	PDB:2agcA	0.071	0.294	1.728E-2	162	0.009	0.062	2agcA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q00756	0.0	1538	1109	0.719	0.728	PPR3A_RABIT Protein phosphatase 1 regulatory subunit 3A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R3A PE=1 SV=1
2	Q99MR9	0.0	1276	1089	0.619	0.637	PPR3A_MOUSE Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp1r3a PE=1 SV=2
3	Q9VVY3	1.19e-21	103	681	0.054	0.090	GBS76_DROME Glycogen-binding subunit 76A OS=Drosophila melanogaster OX=7227 GN=Gbs-76A PE=1 SV=1
4	Q9UQK1	1.99e-19	92.8	317	0.055	0.196	PPR3C_HUMAN Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
5	O95685	2.78e-18	89.0	299	0.052	0.194	PPR3D_HUMAN Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens OX=9606 GN=PPP1R3D PE=1 SV=1
6	Q5U2R5	2.94e-17	86.3	317	0.056	0.199	PPR3C_RAT Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
7	Q6ZSY5	3.36e-17	89.4	799	0.048	0.068	PPR3F_HUMAN Protein phosphatase 1 regulatory subunit 3F OS=Homo sapiens OX=9606 GN=PPP1R3F PE=1 SV=3
8	Q86XI6	5.40e-16	82.0	285	0.055	0.218	PPR3B_HUMAN Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1
9	T1SFR8	6.39e-16	81.6	285	0.053	0.207	PPR3C_CLABA Protein phosphatase 1 regulatory subunit 3C OS=Clarias batrachus OX=59899 GN=PPP1R3C PE=2 SV=1
10	Q6NX94	7.65e-16	80.9	253	0.062	0.277	Q6NX94_DANRE Protein phosphatase 1 regulatory subunit OS=Danio rerio OX=7955 GN=fj66e08 PE=2 SV=1
11	D3ZZ26	8.93e-16	81.3	279	0.051	0.204	D3ZZ26_RAT Protein phosphatase 1, regulatory subunit 3D OS=Rattus norvegicus OX=10116 GN=Ppp1r3d PE=1 SV=1
12	Q7TMB3	2.00e-15	80.9	317	0.051	0.180	PPR3C_MOUSE Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
13	Q8C767	4.30e-15	79.3	284	0.054	0.215	PPR3B_MOUSE Protein phosphatase 1 regulatory subunit 3B OS=Mus musculus OX=10090 GN=Ppp1r3b PE=1 SV=1
14	Q6IN01	1.17e-14	78.2	284	0.053	0.208	PPR3B_RAT Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1
15	Q8SWT8	1.56e-13	75.5	330	0.037	0.127	Q8SWT8_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=2 SV=1
16	Q9VUF3	2.54e-13	75.5	384	0.037	0.109	Q9VUF3_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=4 SV=1
17	Q8SXW5	1.90e-12	72.8	384	0.037	0.107	Q8SXW5_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=2 SV=1
18	P0C7L8	4.20e-08	58.2	279	0.043	0.172	PPR3E_RAT Protein phosphatase 1 regulatory subunit 3E OS=Rattus norvegicus OX=10116 GN=Ppp1r3e PE=2 SV=1
19	Q9CW07	7.01e-08	58.2	347	0.060	0.193	PP13G_MOUSE Protein phosphatase 1 regulatory subunit 3G OS=Mus musculus OX=10090 GN=Ppp1r3g PE=1 SV=2
20	P28006	7.70e-07	55.8	793	0.041	0.058	GAC1_YEAST Serine/threonine-protein phosphatase 1 regulatory subunit GAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAC1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16760 CBM53	5.1e-07	41.6	Starch/carbohydrate-binding module (family 53)
2	PF03370 CBM_21	4.8e-26	102.5	Carbohydrate/starch-binding module (family 21)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284601

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341779	0.971	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
2	9606.ENSP00000303830	0.954	Insulin receptor
3	9606.ENSP00000380432	0.929	Insulin
4	9606.ENSP00000378769	0.926	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
5	9606.ENSP00000326031	0.919	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
6	9606.ENSP00000324806	0.910	Glycogen synthase kinase-3 beta
7	9606.ENSP00000308318	0.860	Protein phosphatase 1 regulatory subunit 3B
8	9606.ENSP00000408288	0.852	Protein phosphatase 1 regulatory subunit 3E
9	9606.ENSP00000238994	0.848	Protein phosphatase 1 regulatory subunit 3C
10	9606.ENSP00000360035	0.847	Protein phosphatase 1 regulatory subunit 3D
11	9606.ENSP00000055335	0.838	Protein phosphatase 1 regulatory subunit 3F
12	9606.ENSP00000261195	0.773	Glycogen [starch] synthase, liver
13	9606.ENSP00000317904	0.766	Glycogen [starch] synthase, muscle
14	9606.ENSP00000323714	0.764	Eukaryotic translation initiation factor 4E type 1B
15	9606.ENSP00000311677	0.756	Nuclear inhibitor of protein phosphatase 1
16	9606.ENSP00000478767	0.726	Neurabin-2
17	9606.ENSP00000418447	0.721	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
18	9606.ENSP00000427015	0.705	Ribosomal protein S6 kinase alpha-2
19	9606.ENSP00000440273	0.700	SH2B adapter protein 2
20	9606.ENSP00000360290	0.696	5'-AMP-activated protein kinase catalytic subunit alpha-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.960	enzyme binding
GO:0003824	0.912	catalytic activity
GO:0016787	0.692	hydrolase activity
GO:0140096	0.622	catalytic activity, acting on a protein
GO:0019902	0.533	phosphatase binding
GO:0019903	0.497	protein phosphatase binding
GO:0016788	0.480	hydrolase activity, acting on ester bonds
GO:0098772	0.415	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0005977	0.991	glycogen metabolic process
GO:0050789	0.645	regulation of biological process
GO:0050794	0.419	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000164	0.995	protein phosphatase type 1 complex
GO:0043226	0.957	organelle
GO:0043229	0.953	intracellular organelle
GO:0005829	0.842	cytosol
GO:0043231	0.803	intracellular membrane-bounded organelle
GO:0016020	0.711	membrane
GO:0071944	0.562	cell periphery
GO:0005634	0.447	nucleus
GO:0005886	0.431	plasma membrane
GO:0005576	0.321	extracellular region
GO:0043233	0.321	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.692	Hydrolases.
EC:3.1.-.-	0.480	Acting on ester bonds.

[back to server]