StarFunc result for job id Q16822

User Input

>input (640 residues)
MAALYRPGLRLNWHGLSPLGWPSCRSIQTLRVLSGDLGQLPTGIRDFVEHSARLCQPEGI
HICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTV
PLPPGGARGQLGNWMSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTD
SAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHV
PDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITSPAGKKRYVAA
AFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGFFGVAPGTSAT
TNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLPPGVTVTSWLGKPWKPGDKEPCAHP
NSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRS
ESTAAAEHKGKIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGAQLPRIFHVNWFRRDEA
GHFLWPGFGENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPK
DFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3dt7A	0.945	0.969	0.000	624	0.691	0.708	3dt7A.pdb.gz	Enzymes with lid-gated active sites must operate by an induced fit mechanism instead of conformational selection.
2	PDB:5v95A	0.907	0.981	0.000	592	0.662	0.716	5v95A.pdb.gz	Asymmetric Anchoring Is Required for Efficient Omega-Loop Opening and Closing in Cytosolic Phosphoenolpyruvate Carboxykinase.
3	AFDB:A0A4X1UM84	0.947	0.974	0.000	622	0.681	0.701	A0A4X1UM84.pdb.gz	PCKGC_PIG Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Sus scrofa OX=9823 GN=PCK1 PE=1 SV=2
4	AFDB:F1LQJ7	0.977	0.976	0.000	641	0.809	0.808	F1LQJ7.pdb.gz	F1LQJ7_RAT phosphoenolpyruvate carboxykinase (GTP) OS=Rattus norvegicus OX=10116 GN=Pck2 PE=1 SV=3
5	AFDB:F1QYH3	0.958	0.973	0.000	630	0.672	0.683	F1QYH3.pdb.gz
6	AFDB:P05153	0.947	0.974	0.000	622	0.675	0.695	P05153.pdb.gz	PCKGC_CHICK Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Gallus gallus OX=9031 GN=PCK1 PE=2 SV=1
7	AFDB:P07379	0.947	0.975	0.000	622	0.691	0.711	P07379.pdb.gz	PCKGC_RAT Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Rattus norvegicus OX=10116 GN=Pck1 PE=1 SV=1
8	AFDB:P21642	0.941	0.939	0.000	641	0.670	0.669	P21642.pdb.gz	PCKGM_CHICK Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Gallus gallus OX=9031 GN=PCK2 PE=1 SV=2
9	AFDB:Q98T97	0.935	0.943	0.000	635	0.662	0.668	Q98T97.pdb.gz	Q98T97_ONCMY phosphoenolpyruvate carboxykinase (GTP) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
10	AFDB:O44906	0.944	0.928	5.973E-103	651	0.556	0.547	O44906.pdb.gz	O44906_CAEEL phosphoenolpyruvate carboxykinase (GTP) OS=Caenorhabditis elegans OX=6239 GN=pck-1 PE=1 SV=2
11	AFDB:H0YM31	0.743	0.933	1.683E-99	509	0.753	0.947	H0YM31.pdb.gz	H0YM31_HUMAN phosphoenolpyruvate carboxykinase (GTP) OS=Homo sapiens OX=9606 GN=PCK2 PE=1 SV=2
12	AFDB:H0YML5	0.735	0.992	7.572E-93	474	0.741	1.000	H0YML5.pdb.gz	H0YML5_HUMAN phosphoenolpyruvate carboxykinase (GTP) OS=Homo sapiens OX=9606 GN=PCK2 PE=1 SV=1
13	PDB:4r43A	0.883	0.939	8.216E-83	601	0.481	0.512	4r43A.pdb.gz	Structural and Functional Studies of Phosphoenolpyruvate Carboxykinase from Mycobacterium tuberculosis.
14	PDB:1os1A	0.664	0.779	1.933E-22	537	0.139	0.166	1os1A.pdb.gz	Mechanisms of activation of phosphoenolpyruvate carboxykinase from Escherichia coli by Ca2+ and of desensitization by trypsin.
15	PDB:4f9vA	0.083	0.144	1.472	307	0.030	0.062	4f9vA.pdb.gz	Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
16	PDB:3bsfA	0.106	0.214	1.649	244	0.041	0.107	3bsfA.pdb.gz	Crystal structure of the MTA/SAH nucleosidase
17	PDB:3dtfA	0.058	0.081	1.649	363	0.034	0.061	3dtfA.pdb.gz	Structural analysis of mycobacterial branched-chain aminotransferase: implications for inhibitor design.
18	PDB:7ls6P	0.084	0.152	1.954	257	0.023	0.058	7ls6P.pdb.gz
19	PDB:2jrcA	0.065	0.145	2.069	191	0.031	0.105	2jrcA.pdb.gz
20	PDB:2vz8A	0.063	0.029	2.069	1962	0.048	0.016	2vz8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384MTT2	0.0	1320	640	1.000	1.000	A0A384MTT2_HUMAN phosphoenolpyruvate carboxykinase (GTP) OS=Homo sapiens OX=9606 GN=PCK2 PE=2 SV=1
2	A0A4X1UM84	0.0	940	622	0.681	0.701	PCKGC_PIG Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Sus scrofa OX=9823 GN=PCK1 PE=1 SV=2
3	A0A8I5ZVZ5	0.0	1087	615	0.838	0.872	A0A8I5ZVZ5_RAT phosphoenolpyruvate carboxykinase (GTP) OS=Rattus norvegicus OX=10116 GN=Pck2 PE=1 SV=1
4	A0A8I6AH39	0.0	1205	645	0.911	0.904	A0A8I6AH39_RAT phosphoenolpyruvate carboxykinase (GTP) OS=Rattus norvegicus OX=10116 GN=Pck2 PE=1 SV=1
5	B2RYG2	0.0	1219	663	0.922	0.890	B2RYG2_RAT phosphoenolpyruvate carboxykinase (GTP) (Fragment) OS=Rattus norvegicus OX=10116 GN=Pck2 PE=2 SV=1
6	F1LQJ7	0.0	1220	667	0.922	0.885	F1LQJ7_RAT phosphoenolpyruvate carboxykinase (GTP) OS=Rattus norvegicus OX=10116 GN=Pck2 PE=1 SV=3
7	H0YM31	0.0	989	509	0.750	0.943	H0YM31_HUMAN phosphoenolpyruvate carboxykinase (GTP) OS=Homo sapiens OX=9606 GN=PCK2 PE=1 SV=2
8	H0YML5	0.0	964	474	0.741	1.000	H0YML5_HUMAN phosphoenolpyruvate carboxykinase (GTP) OS=Homo sapiens OX=9606 GN=PCK2 PE=1 SV=1
9	O44906	0.0	752	651	0.555	0.545	O44906_CAEEL phosphoenolpyruvate carboxykinase (GTP) OS=Caenorhabditis elegans OX=6239 GN=pck-1 PE=1 SV=2
10	P05153	0.0	946	622	0.675	0.695	PCKGC_CHICK Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Gallus gallus OX=9031 GN=PCK1 PE=2 SV=1
11	P07379	0.0	954	622	0.691	0.711	PCKGC_RAT Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Rattus norvegicus OX=10116 GN=Pck1 PE=1 SV=1
12	P21642	0.0	879	641	0.669	0.668	PCKGM_CHICK Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Gallus gallus OX=9031 GN=PCK2 PE=1 SV=2
13	P35558	0.0	946	622	0.683	0.703	PCKGC_HUMAN Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Homo sapiens OX=9606 GN=PCK1 PE=1 SV=3
14	P9WIH3	0.0	565	606	0.475	0.502	PCKG_MYCTU Phosphoenolpyruvate carboxykinase [GTP] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pckG PE=1 SV=1
15	Q16822	0.0	1320	640	1.000	1.000	PCKGM_HUMAN Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Homo sapiens OX=9606 GN=PCK2 PE=1 SV=4
16	Q7T3G9	0.0	938	630	0.672	0.683	Q7T3G9_DANRE phosphoenolpyruvate carboxykinase (GTP) OS=Danio rerio OX=7955 GN=cb924 PE=2 SV=1
17	Q8BH04	0.0	1225	640	0.922	0.922	PCKGM_MOUSE Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Mus musculus OX=10090 GN=Pck2 PE=1 SV=1
18	Q98T97	0.0	894	635	0.659	0.665	Q98T97_ONCMY phosphoenolpyruvate carboxykinase (GTP) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
19	Q9Z2V4	0.0	954	622	0.689	0.709	PCKGC_MOUSE Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Mus musculus OX=10090 GN=Pck1 PE=1 SV=1
20	P0C6F1	4.1	33.1	4456	0.034	0.005	DYH2_MOUSE Dynein axonemal heavy chain 2 OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00821 PEPCK_GTP	4.8e-167	566.9	Phosphoenolpyruvate carboxykinase C-terminal P-loop domain
2	PF17297 PEPCK_N	5e-92	319.0	Phosphoenolpyruvate carboxykinase N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216780

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377532	0.981	Pyruvate carboxylase, mitochondrial
2	9606.ENSP00000339933	0.963	Pyruvate kinase PKLR
3	9606.ENSP00000320171	0.955	Pyruvate kinase PKM
4	9606.ENSP00000342056	0.954	Citrate synthase, mitochondrial
5	9606.ENSP00000438144	0.954	Malate dehydrogenase, cytoplasmic
6	9606.ENSP00000327070	0.952	Malate dehydrogenase, mitochondrial
7	9606.ENSP00000253792	0.951	ATP-citrate synthase
8	9606.ENSP00000234590	0.945	Alpha-enolase
9	9606.ENSP00000324105	0.938	Beta-enolase
10	9606.ENSP00000437402	0.935	Gamma-enolase
11	9606.ENSP00000345555	0.926	Enolase 4
12	9606.ENSP00000253801	0.895	Glucose-6-phosphatase
13	9606.ENSP00000280346	0.893	Dihydrolipoamide S-acetyltransferase
14	9606.ENSP00000245206	0.867	Aspartate aminotransferase, mitochondrial
15	9606.ENSP00000253382	0.866	Acetyl-coenzyme A synthetase, cytoplasmic
16	9606.ENSP00000277865	0.865	Glutamate dehydrogenase 1, mitochondrial
17	9606.ENSP00000307241	0.863	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
18	9606.ENSP00000327589	0.849	Glutamate dehydrogenase 2, mitochondrial
19	9606.ENSP00000359539	0.849	Aspartate aminotransferase, cytoplasmic
20	9606.ENSP00000316924	0.847	Acetyl-coenzyme A synthetase 2-like, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004613	0.996	phosphoenolpyruvate carboxykinase (GTP) activity
GO:0005488	0.962	binding
GO:0005515	0.373	protein binding
GO:0097159	0.306	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044281	0.992	small molecule metabolic process
GO:0009987	0.986	cellular process
GO:0044237	0.984	cellular metabolic process
GO:0005975	0.935	carbohydrate metabolic process
GO:0005996	0.926	monosaccharide metabolic process
GO:0006006	0.920	glucose metabolic process
GO:0019319	0.916	hexose biosynthetic process
GO:0006094	0.914	gluconeogenesis
GO:0050896	0.870	response to stimulus
GO:0065007	0.801	biological regulation
GO:0019752	0.761	carboxylic acid metabolic process
GO:0050789	0.709	regulation of biological process
GO:0051716	0.607	cellular response to stimulus
GO:0032787	0.601	monocarboxylic acid metabolic process
GO:0050794	0.583	regulation of cellular process
GO:0042221	0.545	response to chemical
GO:0043648	0.409	dicarboxylic acid metabolic process
GO:0006090	0.389	pyruvate metabolic process
GO:0010033	0.366	response to organic substance
GO:0070887	0.341	cellular response to chemical stimulus
GO:0048518	0.336	positive regulation of biological process
GO:0006807	0.323	nitrogen compound metabolic process
GO:0048522	0.316	positive regulation of cellular process
GO:0042592	0.300	homeostatic process
GO:1901701	0.300	cellular response to oxygen-containing compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.982	intracellular organelle lumen
GO:0005759	0.562	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10388	0.996	GTP + oxaloacetate = CO2 + GDP + phosphoenolpyruvate
EC:4.1.1.32	0.996	phosphoenolpyruvate carboxykinase (GTP).

[back to server]