StarFunc result for job id Q16827

User Input

>input (1216 residues)
MGHLPTGIHGARRLLPLLWLFVLFKNATAFHVTVQDDNNIVVSLEASDVISPASVYVVKI
TGESKNYFFEFEEFNSTLPPPVIFKASYHGLYYIITLVVVNGNVVTKPSRSITVLTKPLP
VTSVSIYDYKPSPETGVLFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNH
WLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNW
EEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWPDFNSSDYETTSQPYWW
DSASAAPESEDEFVSVLPMEYENNSTLSETEKSTSGSFSFFPVQMILTWLPPKPPTAFDG
FHIHIEREENFTEYLMVDEEAHEFVAELKEPGKYKLSVTTFSSSGSCETRKSQSAKSLSF
YISPSGEWIEELTEKPQHVSVHVLSSTTALMSWTSSQENYNSTIVSVVSLTCQKQKESQR
LEKQYCTQVNSSKPIIENLVPGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYP
LGPTAVVLSWTRPYLGVFRKYVVEMFYFNPATMTSEWTTYYEIAATVSLTASVRIANLLP
AWYYNFRVTMVTWGDPELSCCDSSTISFITAPVAPEITSVEYFNSLLYISWTYGDDTTDL
SHSRMLHWMVVAEGKKKIKKSVTRNVMTAILSLPPGDIYNLSVTACTERGSNTSMLRLVK
LEPAPPKSLFAVNKTQTSVTLLWVEEGVADFFEVFCQQVGSSQKTKLQEPVAVSSHVVTI
SSLLPATAYNCSVTSFSHDSPSVPTFIAVSTMVTEMNPNVVVISVLAILSTLLIGLLLVT
LIILRKKHLQMARECGAGTFVNFASLERDGKLPYNWRRSIFAFLTLLPSCLWTDYLLAFY
INPWSKNGLKKRKLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLP
LNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRND
FWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRH
FRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGV
GRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKK
QQFCISDVIYENVSKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q612	0.797	0.791	0.000	1226	0.916	0.909	E9Q612.pdb.gz	PTPRO_MOUSE Receptor-type tyrosine-protein phosphatase O OS=Mus musculus OX=10090 GN=Ptpro PE=1 SV=1
2	AFDB:F1NMQ6	0.567	0.547	0.000	1268	0.847	0.812	F1NMQ6.pdb.gz
3	AFDB:Q28613	0.423	0.432	0.000	1187	0.942	0.965	Q28613.pdb.gz	Q28613_RABIT protein-tyrosine-phosphatase OS=Oryctolagus cuniculus OX=9986 GN=PTPRO PE=2 SV=1
4	AFDB:E9Q0N2	0.252	0.313	2.051E-60	971	0.205	0.256	E9Q0N2.pdb.gz	PTPRH_MOUSE Receptor-type tyrosine-protein phosphatase H OS=Mus musculus OX=10090 GN=Ptprh PE=1 SV=1
5	AFDB:A0A0R4ITJ9	0.245	0.159	3.667E-60	1892	0.231	0.149	A0A0R4ITJ9.pdb.gz	A0A0R4ITJ9_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=R-PTP-beta PE=3 SV=2
6	AFDB:Q12913	0.255	0.237	8.355E-60	1337	0.222	0.202	Q12913.pdb.gz	PTPRJ_HUMAN Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens OX=9606 GN=PTPRJ PE=1 SV=3
7	AFDB:Q9HD43	0.233	0.254	8.770E-60	1115	0.215	0.235	Q9HD43.pdb.gz	PTPRH_HUMAN Receptor-type tyrosine-protein phosphatase H OS=Homo sapiens OX=9606 GN=PTPRH PE=1 SV=4
8	AFDB:Q9UMZ3	0.234	0.124	1.173E-59	2332	0.216	0.113	Q9UMZ3.pdb.gz	PTPRQ_HUMAN Phosphatidylinositol phosphatase PTPRQ OS=Homo sapiens OX=9606 GN=PTPRQ PE=1 SV=2
9	AFDB:Q64455	0.238	0.234	1.904E-59	1238	0.209	0.205	Q64455.pdb.gz	PTPRJ_MOUSE Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus OX=10090 GN=Ptprj PE=1 SV=2
10	AFDB:B6HY54	0.234	0.173	5.799E-59	1650	0.194	0.143	B6HY54.pdb.gz	B6HY54_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=dep1a PE=2 SV=1
11	PDB:3ps5A	0.231	0.519	4.267E-23	529	0.105	0.242	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
12	PDB:4gwfA	0.232	0.552	5.706E-23	497	0.090	0.221	4gwfA.pdb.gz
13	PDB:5xzrA	0.231	0.527	2.561E-22	519	0.090	0.212	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
14	PDB:6krwA	0.203	0.754	2.874E-19	306	0.081	0.320	6krwA.pdb.gz
15	PDB:3m4uA	0.201	0.804	1.481E-14	285	0.068	0.291	3m4uA.pdb.gz
16	PDB:6h03A	0.118	0.118	2.842E-13	1223	0.074	0.074	6h03A.pdb.gz
17	PDB:7q1yA	0.129	0.117	4.395E-13	1374	0.066	0.058	7q1yA.pdb.gz
18	PDB:1e07A	0.144	0.234	4.613E-13	642	0.051	0.097	1e07A.pdb.gz
19	PDB:4ziqA	0.103	0.090	1.304E-11	1450	0.069	0.058	4ziqA.pdb.gz
20	PDB:5a42A	0.111	0.091	2.448E-11	1597	0.074	0.056	5a42A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5YC57	0.0	2189	1188	0.890	0.911	A0A8I5YC57_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpro PE=4 SV=1
2	A4IFW3	0.0	1431	1238	0.588	0.578	A4IFW3_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=ptpro PE=1 SV=1
3	E9Q612	0.0	2263	1226	0.917	0.909	PTPRO_MOUSE Receptor-type tyrosine-protein phosphatase O OS=Mus musculus OX=10090 GN=Ptpro PE=1 SV=1
4	F7F9Z5	0.0	2256	1215	0.897	0.898	F7F9Z5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpro PE=4 SV=1
5	Q16827	0.0	2529	1216	1.000	1.000	PTPRO_HUMAN Receptor-type tyrosine-protein phosphatase O OS=Homo sapiens OX=9606 GN=PTPRO PE=1 SV=2
6	Q28613	0.0	2298	1187	0.942	0.965	Q28613_RABIT protein-tyrosine-phosphatase OS=Oryctolagus cuniculus OX=9986 GN=PTPRO PE=2 SV=1
7	Q62797	0.0	2261	1216	0.911	0.911	Q62797_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpro PE=4 SV=1
8	Q98945	0.0	2096	1267	0.849	0.815	Q98945_CHICK protein-tyrosine-phosphatase OS=Gallus gallus OX=9031 PE=1 SV=1
9	B2RU80	6.85e-87	313	1998	0.127	0.077	PTPRB_MOUSE Receptor-type tyrosine-protein phosphatase beta OS=Mus musculus OX=10090 GN=Ptprb PE=1 SV=1
10	P35992	7.87e-87	313	1990	0.115	0.070	PTP10_DROME Tyrosine-protein phosphatase 10D OS=Drosophila melanogaster OX=7227 GN=Ptp10D PE=1 SV=4
11	A0A0G2K2W0	1.04e-86	313	2240	0.126	0.068	A0A0G2K2W0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=1 SV=2
12	A0A8I5ZXS1	1.06e-86	313	2238	0.126	0.068	A0A8I5ZXS1_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=3 SV=1
13	D3ZTG5	1.87e-86	312	2004	0.126	0.076	D3ZTG5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=1 SV=3
14	A0A8I5ZV35	1.95e-86	312	2000	0.126	0.076	A0A8I5ZV35_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=3 SV=1
15	P23467	1.16e-85	309	1997	0.127	0.077	PTPRB_HUMAN Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens OX=9606 GN=PTPRB PE=1 SV=3
16	Q8IRS0	1.16e-84	306	1607	0.118	0.089	Q8IRS0_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
17	E1JJE4	1.23e-84	306	1615	0.118	0.089	E1JJE4_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
18	Q9W4F5	1.50e-84	306	1767	0.118	0.081	Q9W4F5_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=2 SV=1
19	X2JCK2	1.59e-84	306	1761	0.118	0.081	X2JCK2_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
20	Q24495	2.12e-83	302	1767	0.117	0.080	Q24495_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06395 CDC24	3e+02	13.1	CDC24 Calponin
2	PF00782 DSPc	0.18	23.1	Dual specificity phosphatase, catalytic domain
3	PF00041 fn3	4.2e-22	89.6	Fibronectin type III domain
4	PF14566 PTPlike_phytase	1.6	20.3	Inositol hexakisphosphate
5	PF16656 Pur_ac_phosph_N	0.046	25.7	Purple acid Phosphatase, N-terminal domain
6	PF00102 Y_phosphatase	3.6e-80	280.5	Protein-tyrosine phosphatase
7	PF13350 Y_phosphatase3	0.086	24.4	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281171

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354207	0.942	NT-3 growth factor receptor
2	9606.ENSP00000288135	0.927	Mast/stem cell growth factor receptor Kit
3	9606.ENSP00000397297	0.906	Neurotrophin-3
4	9606.ENSP00000228280	0.900	Kit ligand
5	9606.ENSP00000356587	0.712	Podocin
6	9606.ENSP00000368190	0.695	Nephrin
7	9606.ENSP00000377789	0.681	Synaptopodin
8	9606.ENSP00000280362	0.680	6-pyruvoyl tetrahydrobiopterin synthase
9	9606.ENSP00000367817	0.630	Podocalyxin
10	9606.ENSP00000246071	0.580	U2 small nuclear ribonucleoprotein B'
11	9606.ENSP00000362650	0.566	Protein SCAI
12	9606.ENSP00000331327	0.565	Wilms tumor protein
13	9606.ENSP00000478070	0.565	CWC25 spliceosome associated protein homolog
14	9606.ENSP00000346839	0.535	Fibronectin type III domain containing
15	9606.ENSP00000360431	0.534	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
16	9606.ENSP00000252699	0.525	Alpha-actinin-4
17	9606.ENSP00000364907	0.517	Tyrosine-protein kinase SYK
18	9606.ENSP00000376410	0.510	Inverted formin-2
19	9606.ENSP00000352264	0.504	CD2-associated protein
20	9606.ENSP00000301408	0.501	Chorionic gonadotropin beta subunit 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0005515	0.991	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.984	regulation of biological process
GO:0032501	0.982	multicellular organismal process
GO:0050896	0.955	response to stimulus
GO:0071704	0.949	organic substance metabolic process
GO:0006470	0.935	protein dephosphorylation
GO:0048856	0.933	anatomical structure development
GO:0007275	0.917	multicellular organism development
GO:0050794	0.885	regulation of cellular process
GO:0048519	0.880	negative regulation of biological process
GO:0048731	0.869	system development
GO:0051716	0.801	cellular response to stimulus
GO:0048513	0.748	animal organ development
GO:0072006	0.687	nephron development
GO:0051239	0.635	regulation of multicellular organismal process
GO:0035335	0.632	peptidyl-tyrosine dephosphorylation
GO:0050878	0.587	regulation of body fluid levels
GO:0040011	0.557	locomotion
GO:0003014	0.524	renal system process
GO:0032835	0.524	glomerulus development
GO:0003073	0.514	regulation of systemic arterial blood pressure
GO:0042221	0.510	response to chemical
GO:0044057	0.495	regulation of system process
GO:0048523	0.463	negative regulation of cellular process
GO:0048583	0.446	regulation of response to stimulus
GO:0009605	0.428	response to external stimulus
GO:0071840	0.381	cellular component organization or biogenesis
GO:0019222	0.359	regulation of metabolic process
GO:0016043	0.355	cellular component organization
GO:0060255	0.343	regulation of macromolecule metabolic process
GO:0042330	0.333	taxis
GO:0010646	0.329	regulation of cell communication
GO:0023051	0.327	regulation of signaling
GO:0080090	0.301	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043227	0.998	membrane-bounded organelle
GO:0005886	0.991	plasma membrane
GO:0005576	0.983	extracellular region
GO:0031982	0.945	vesicle
GO:0005622	0.936	intracellular anatomical structure
GO:0043230	0.898	extracellular organelle
GO:0043229	0.896	intracellular organelle
GO:1903561	0.888	extracellular vesicle
GO:0070062	0.878	extracellular exosome
GO:0043231	0.786	intracellular membrane-bounded organelle
GO:0005737	0.733	cytoplasm
GO:0120025	0.671	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]