StarFunc result for job id Q16828

User Input

>input (381 residues)
MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPG
IMLRRLQKGNLPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFSLHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI
ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS
VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQ
QLYFTTPSNQNVYQVDSLQST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RBC1	0.668	0.668	3.286E-74	381	1.000	1.000	A0A024RBC1.pdb.gz
2	AFDB:Q7T2L8	0.616	0.614	2.828E-67	382	0.816	0.814	Q7T2L8.pdb.gz	Q7T2L8_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=mkp3 PE=2 SV=1
3	AFDB:Q16829	0.808	0.742	2.925E-60	419	0.696	0.632	Q16829.pdb.gz	DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens OX=9606 GN=DUSP7 PE=1 SV=4
4	AFDB:Q99956	0.488	0.485	2.050E-43	384	0.549	0.544	Q99956.pdb.gz	DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens OX=9606 GN=DUSP9 PE=1 SV=1
5	AFDB:Q7TNL7	0.420	0.358	2.518E-42	452	0.556	0.469	Q7TNL7.pdb.gz	Q7TNL7_MOUSE Dual specificity protein phosphatase OS=Mus musculus OX=10090 GN=Dusp9 PE=1 SV=1
6	AFDB:Q9VVW5	0.463	0.432	1.436E-37	411	0.365	0.338	Q9VVW5.pdb.gz	DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster OX=7227 GN=Mkp3 PE=1 SV=2
7	AFDB:A0A2R8QPP3	0.377	0.391	1.070E-31	367	0.307	0.319	A0A2R8QPP3.pdb.gz
8	AFDB:Q91790	0.391	0.402	1.745E-31	369	0.307	0.317	Q91790.pdb.gz	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
9	AFDB:P28562	0.372	0.386	5.932E-31	367	0.320	0.332	P28562.pdb.gz	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
10	AFDB:Q9ESS0	0.371	0.294	1.236E-30	483	0.291	0.230	Q9ESS0.pdb.gz	DUS10_MOUSE Dual specificity protein phosphatase 10 OS=Mus musculus OX=10090 GN=Dusp10 PE=2 SV=2
11	PDB:6d66A	0.371	0.275	6.035E-17	517	0.181	0.133	6d66A.pdb.gz
12	PDB:2wgpA	0.364	0.813	1.642E-15	168	0.142	0.321	2wgpA.pdb.gz
13	PDB:2esbA	0.365	0.844	9.313E-14	162	0.113	0.265	2esbA.pdb.gz
14	PDB:3f81A	0.357	0.731	3.045E-12	179	0.150	0.318	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
15	PDB:5y15A	0.355	0.891	4.968E-12	148	0.102	0.264	5y15A.pdb.gz
16	PDB:2gwoC	0.347	0.745	3.519E-11	174	0.115	0.253	2gwoC.pdb.gz
17	PDB:5xjvB	0.339	0.740	9.366E-11	171	0.115	0.257	5xjvB.pdb.gz
18	PDB:2y96A	0.335	0.707	4.323E-10	175	0.115	0.251	2y96A.pdb.gz
19	PDB:4ercA	0.334	0.805	4.700E-9	150	0.068	0.173	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
20	PDB:2q05A	0.287	0.573	3.539E-8	181	0.105	0.221	2q05A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16828	0.0	783	381	1.000	1.000	DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens OX=9606 GN=DUSP6 PE=1 SV=2
2	Q16829	0.0	530	419	0.688	0.625	DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens OX=9606 GN=DUSP7 PE=1 SV=4
3	Q64346	0.0	774	381	0.987	0.987	DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus OX=10116 GN=Dusp6 PE=1 SV=1
4	Q7T2L8	0.0	605	382	0.803	0.801	Q7T2L8_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=mkp3 PE=2 SV=1
5	Q9DBB1	0.0	768	381	0.982	0.982	DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus OX=10090 GN=Dusp6 PE=1 SV=1
6	Q99956	5.75e-113	336	384	0.541	0.536	DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens OX=9606 GN=DUSP9 PE=1 SV=1
7	Q7TNL7	4.53e-110	331	452	0.459	0.387	Q7TNL7_MOUSE Dual specificity protein phosphatase OS=Mus musculus OX=10090 GN=Dusp9 PE=1 SV=1
8	F8VZA4	1.75e-80	244	117	0.307	1.000	F8VZA4_HUMAN Dual specificity phosphatase 6 (Fragment) OS=Homo sapiens OX=9606 GN=DUSP6 PE=1 SV=1
9	Q9VVW5	2.96e-71	230	411	0.365	0.338	DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster OX=7227 GN=Mkp3 PE=1 SV=2
10	Q62767	2.42e-52	181	395	0.318	0.306	DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Dusp4 PE=1 SV=1
11	D4A3W6	2.96e-51	183	661	0.310	0.179	D4A3W6_RAT Dual specificity phosphatase 16 OS=Rattus norvegicus OX=10116 GN=Dusp16 PE=1 SV=1
12	Q13115	5.36e-51	177	394	0.312	0.302	DUS4_HUMAN Dual specificity protein phosphatase 4 OS=Homo sapiens OX=9606 GN=DUSP4 PE=1 SV=1
13	D3ZBG7	1.08e-50	178	482	0.310	0.245	D3ZBG7_RAT Dual specificity phosphatase 10 OS=Rattus norvegicus OX=10116 GN=Dusp10 PE=3 SV=1
14	Q7SZF3	1.15e-50	175	367	0.307	0.319	Q7SZF3_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=zgc:55423 PE=2 SV=1
15	Q9BY84	3.34e-50	180	665	0.289	0.165	DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens OX=9606 GN=DUSP16 PE=1 SV=1
16	P28562	3.55e-50	174	367	0.299	0.311	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
17	Q9ESS0	4.39e-50	177	483	0.307	0.242	DUS10_MOUSE Dual specificity protein phosphatase 10 OS=Mus musculus OX=10090 GN=Dusp10 PE=2 SV=2
18	P28563	2.87e-49	172	367	0.304	0.316	DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus OX=10090 GN=Dusp1 PE=1 SV=1
19	Q9Y6W6	4.57e-49	174	482	0.297	0.234	DUS10_HUMAN Dual specificity protein phosphatase 10 OS=Homo sapiens OX=9606 GN=DUSP10 PE=1 SV=1
20	Q05923	6.18e-49	169	314	0.312	0.379	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	1.3e-39	146.5	Dual specificity phosphatase, catalytic domain
2	PF04179 Init_tRNA_PT	32	16.2	Rit1 DUSP-like domain
3	PF14566 PTPlike_phytase	6.3e+02	11.9	Inositol hexakisphosphate
4	PF00581 Rhodanese	1.7e-10	52.7	Rhodanese-like domain
5	PF00102 Y_phosphatase	1.4	20.0	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000279488

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215832	0.999	Mitogen-activated protein kinase 1
2	9606.ENSP00000263025	0.997	Mitogen-activated protein kinase 3
3	9606.ENSP00000229795	0.972	Mitogen-activated protein kinase 14
4	9606.ENSP00000311005	0.968	Mitogen-activated protein kinase 7
5	9606.ENSP00000378974	0.945	Mitogen-activated protein kinase 8
6	9606.ENSP00000240100	0.919	Dual specificity protein phosphatase 4
7	9606.ENSP00000239223	0.918	Dual specificity protein phosphatase 1
8	9606.ENSP00000380530	0.917	Dual specificity protein phosphatase 8
9	9606.ENSP00000288943	0.911	Dual specificity protein phosphatase 2
10	9606.ENSP00000345853	0.911	Dual specificity protein phosphatase 9
11	9606.ENSP00000368880	0.758	Forkhead box protein O1
12	9606.ENSP00000344967	0.753	Protein sprouty homolog 4
13	9606.ENSP00000366306	0.738	Protein sprouty homolog 2
14	9606.ENSP00000283228	0.717	Receptor-type tyrosine-protein phosphatase R
15	9606.ENSP00000262506	0.714	Casein kinase II subunit alpha
16	9606.ENSP00000469880	0.709	Inactive serine/threonine-protein kinase VRK3
17	9606.ENSP00000369756	0.704	Receptor-type tyrosine-protein phosphatase alpha
18	9606.ENSP00000302486	0.700	Dual specificity mitogen-activated protein kinase kinase 1
19	9606.ENSP00000407586	0.687	GTPase HRas
20	9606.ENSP00000321797	0.681	Fibroblast growth factor 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004721	1.000	phosphoprotein phosphatase activity
GO:0005515	0.996	protein binding
GO:0008138	0.987	protein tyrosine/serine/threonine phosphatase activity
GO:0004725	0.888	protein tyrosine phosphatase activity
GO:0033549	0.857	MAP kinase phosphatase activity
GO:0019899	0.444	enzyme binding
GO:0019900	0.411	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0048523	0.989	negative regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0008152	0.987	metabolic process
GO:0048583	0.984	regulation of response to stimulus
GO:0044237	0.981	cellular metabolic process
GO:0071704	0.977	organic substance metabolic process
GO:0044238	0.974	primary metabolic process
GO:0009966	0.967	regulation of signal transduction
GO:0006807	0.965	nitrogen compound metabolic process
GO:0043170	0.958	macromolecule metabolic process
GO:0043409	0.953	negative regulation of MAPK cascade
GO:0006470	0.952	protein dephosphorylation
GO:0048518	0.879	positive regulation of biological process
GO:0070372	0.876	regulation of ERK1 and ERK2 cascade
GO:0019222	0.873	regulation of metabolic process
GO:0048522	0.871	positive regulation of cellular process
GO:0051716	0.863	cellular response to stimulus
GO:0060255	0.863	regulation of macromolecule metabolic process
GO:0031323	0.860	regulation of cellular metabolic process
GO:0080090	0.832	regulation of primary metabolic process
GO:0051171	0.812	regulation of nitrogen compound metabolic process
GO:0023052	0.776	signaling
GO:0007154	0.760	cell communication
GO:0007165	0.749	signal transduction
GO:0070373	0.706	negative regulation of ERK1 and ERK2 cascade
GO:0035335	0.666	peptidyl-tyrosine dephosphorylation
GO:0032502	0.569	developmental process
GO:0042221	0.504	response to chemical
GO:0048856	0.462	anatomical structure development
GO:0051246	0.453	regulation of protein metabolic process
GO:0010941	0.413	regulation of cell death
GO:0050793	0.412	regulation of developmental process
GO:0040008	0.405	regulation of growth
GO:0006950	0.400	response to stress
GO:0032501	0.390	multicellular organismal process
GO:0001932	0.345	regulation of protein phosphorylation
GO:0010604	0.344	positive regulation of macromolecule metabolic process
GO:0065009	0.341	regulation of molecular function
GO:0035556	0.330	intracellular signal transduction
GO:0000165	0.320	MAPK cascade
GO:0010605	0.319	negative regulation of macromolecule metabolic process
GO:0007275	0.317	multicellular organism development
GO:0051239	0.313	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.998	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
RHEA:10684	0.888	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.888	protein-tyrosine-phosphatase.

[back to server]