StarFunc result for job id Q16829

User Input

>input (419 residues)
MKNQLRGPPARAHMSTSGAAAAGGTRAGSEPGAGSGSGAGTGAGAATGAGAMPCKSAEWL
QEELEARGGASLLLLDCRPHELFESSHIETAINLAIPGLMLRRLRKGNLPIRSIIPNHAD
KERFATRCKAATVLLYDEATAEWQPEPGAPASVLGLLLQKLRDDGCQAYYLQGGFNKFQT
EYSEHCETNVDSSSSPSSSPPTSVLGLGGLRISSDCSDGESDRELPSSATESDGSPVPSS
QPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKYILNVTPNLPNAFEHGGEFTYKQIPISD
HWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKMNLSLNDAYDF
VKRKKSNISPNFNFMGQLLDFERTLGLSSPCDNHASSEQLYFSTPTNHNLFPLNTLEST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16829	1.000	1.000	1.153E-85	419	1.000	1.000	Q16829.pdb.gz	DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens OX=9606 GN=DUSP7 PE=1 SV=4
2	AFDB:Q7T2L8	0.641	0.694	4.598E-60	382	0.635	0.696	Q7T2L8.pdb.gz	Q7T2L8_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=mkp3 PE=2 SV=1
3	AFDB:A0A024RBC1	0.633	0.689	5.205E-60	381	0.628	0.690	A0A024RBC1.pdb.gz
4	AFDB:Q99956	0.459	0.494	5.632E-44	384	0.501	0.547	Q99956.pdb.gz	DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens OX=9606 GN=DUSP9 PE=1 SV=1
5	AFDB:Q7TNL7	0.381	0.355	5.258E-43	452	0.525	0.487	Q7TNL7.pdb.gz	Q7TNL7_MOUSE Dual specificity protein phosphatase OS=Mus musculus OX=10090 GN=Dusp9 PE=1 SV=1
6	AFDB:Q9VVW5	0.454	0.461	1.897E-39	411	0.368	0.375	Q9VVW5.pdb.gz	DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster OX=7227 GN=Mkp3 PE=1 SV=2
7	AFDB:Q91790	0.385	0.428	1.028E-31	369	0.294	0.333	Q91790.pdb.gz	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
8	AFDB:Q9ESS0	0.337	0.292	1.798E-31	483	0.277	0.240	Q9ESS0.pdb.gz	DUS10_MOUSE Dual specificity protein phosphatase 10 OS=Mus musculus OX=10090 GN=Dusp10 PE=2 SV=2
9	AFDB:A0A2R8QPP3	0.344	0.391	6.616E-31	367	0.294	0.335	A0A2R8QPP3.pdb.gz
10	AFDB:P28562	0.341	0.388	7.490E-31	367	0.308	0.351	P28562.pdb.gz	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
11	PDB:6d66A	0.329	0.267	1.467E-16	517	0.162	0.132	6d66A.pdb.gz
12	PDB:2wgpA	0.333	0.816	2.729E-16	168	0.136	0.339	2wgpA.pdb.gz
13	PDB:2esbA	0.332	0.842	2.865E-14	162	0.115	0.296	2esbA.pdb.gz
14	PDB:5y15A	0.326	0.896	6.376E-13	148	0.105	0.297	5y15A.pdb.gz
15	PDB:3f81A	0.335	0.758	3.008E-12	179	0.126	0.296	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
16	PDB:2gwoC	0.323	0.759	2.988E-11	174	0.110	0.264	2gwoC.pdb.gz
17	PDB:5xjvB	0.304	0.725	5.912E-11	171	0.110	0.269	5xjvB.pdb.gz
18	PDB:2y96A	0.315	0.732	1.170E-10	175	0.110	0.263	2y96A.pdb.gz
19	PDB:4ercA	0.300	0.791	2.948E-9	150	0.069	0.193	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
20	PDB:4rkkA	0.294	0.381	1.574E-8	317	0.072	0.095	4rkkA.pdb.gz	Structural mechanism of laforin function in glycogen dephosphorylation and lafora disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16829	0.0	865	419	1.000	1.000	DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens OX=9606 GN=DUSP7 PE=1 SV=4
2	Q7T2L8	0.0	514	382	0.635	0.696	Q7T2L8_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=mkp3 PE=2 SV=1
3	Q16828	6.15e-179	505	381	0.616	0.677	DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens OX=9606 GN=DUSP6 PE=1 SV=2
4	Q9DBB1	1.72e-178	504	381	0.616	0.677	DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus OX=10090 GN=Dusp6 PE=1 SV=1
5	Q64346	2.34e-177	501	381	0.611	0.672	DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus OX=10116 GN=Dusp6 PE=1 SV=1
6	Q99956	3.13e-112	336	384	0.499	0.544	DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens OX=9606 GN=DUSP9 PE=1 SV=1
7	Q7TNL7	1.09e-108	329	452	0.418	0.387	Q7TNL7_MOUSE Dual specificity protein phosphatase OS=Mus musculus OX=10090 GN=Dusp9 PE=1 SV=1
8	Q9VVW5	1.52e-78	250	411	0.344	0.350	DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster OX=7227 GN=Mkp3 PE=1 SV=2
9	Q62767	4.10e-54	186	395	0.289	0.306	DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Dusp4 PE=1 SV=1
10	Q13115	8.02e-54	186	394	0.289	0.307	DUS4_HUMAN Dual specificity protein phosphatase 4 OS=Homo sapiens OX=9606 GN=DUSP4 PE=1 SV=1
11	Q05922	2.56e-53	182	318	0.284	0.374	DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus OX=10090 GN=Dusp2 PE=1 SV=2
12	P28562	2.58e-53	183	367	0.284	0.324	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
13	Q7SZF3	2.84e-53	183	367	0.305	0.349	Q7SZF3_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=zgc:55423 PE=2 SV=1
14	P28563	5.76e-53	182	367	0.282	0.322	DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus OX=10090 GN=Dusp1 PE=1 SV=1
15	Q05923	9.42e-53	180	314	0.279	0.373	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
16	Q91790	3.01e-52	181	369	0.308	0.350	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
17	Q64623	3.08e-52	181	367	0.284	0.324	DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Dusp1 PE=1 SV=1
18	Q16690	1.02e-51	180	384	0.286	0.312	DUS5_HUMAN Dual specificity protein phosphatase 5 OS=Homo sapiens OX=9606 GN=DUSP5 PE=1 SV=2
19	V6CIV8	9.94e-50	174	381	0.277	0.304	DUSL_CAEEL Dual specificity protein phosphatase lip-1 OS=Caenorhabditis elegans OX=6239 GN=lip-1 PE=1 SV=1
20	D4A3W6	1.03e-48	177	661	0.267	0.169	D4A3W6_RAT Dual specificity phosphatase 16 OS=Rattus norvegicus OX=10116 GN=Dusp16 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	8.8e-40	147.0	Dual specificity phosphatase, catalytic domain
2	PF04179 Init_tRNA_PT	16	17.2	Rit1 DUSP-like domain
3	PF14566 PTPlike_phytase	1.6e+02	13.8	Inositol hexakisphosphate
4	PF00581 Rhodanese	3.9e-06	38.7	Rhodanese-like domain
5	PF00102 Y_phosphatase	1.7	19.7	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417183

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215832	0.987	Mitogen-activated protein kinase 1
2	9606.ENSP00000263025	0.977	Mitogen-activated protein kinase 3
3	9606.ENSP00000311005	0.950	Mitogen-activated protein kinase 7
4	9606.ENSP00000229795	0.934	Mitogen-activated protein kinase 14
5	9606.ENSP00000345853	0.878	Dual specificity protein phosphatase 9
6	9606.ENSP00000215659	0.790	Mitogen-activated protein kinase 12
7	9606.ENSP00000283228	0.781	Receptor-type tyrosine-protein phosphatase R
8	9606.ENSP00000333685	0.774	Mitogen-activated protein kinase 11
9	9606.ENSP00000378974	0.774	Mitogen-activated protein kinase 8
10	9606.ENSP00000211287	0.764	Mitogen-activated protein kinase 13
11	9606.ENSP00000369756	0.739	Receptor-type tyrosine-protein phosphatase alpha
12	9606.ENSP00000254667	0.701	Receptor-type tyrosine-protein phosphatase epsilon
13	9606.ENSP00000377001	0.689	Speckle-type POZ protein
14	9606.ENSP00000222254	0.686	Phosphatidylinositol 3-kinase regulatory subunit beta
15	9606.ENSP00000357055	0.677	Astrocytic phosphoprotein PEA-15
16	9606.ENSP00000352157	0.673	Mitogen-activated protein kinase 10
17	9606.ENSP00000394560	0.669	Mitogen-activated protein kinase 9
18	9606.ENSP00000233154	0.656	Cytoplasmic protein NCK2
19	9606.ENSP00000418112	0.598	Receptor-type tyrosine-protein phosphatase gamma
20	9606.ENSP00000356437	0.592	SAM and SH3 domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008138	1.000	protein tyrosine/serine/threonine phosphatase activity
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0033549	0.999	MAP kinase phosphatase activity
GO:0019899	0.661	enzyme binding
GO:0019900	0.515	kinase binding
GO:0019901	0.501	protein kinase binding
GO:0017017	0.427	MAP kinase tyrosine/serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.990	cellular metabolic process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0050896	0.980	response to stimulus
GO:0043170	0.978	macromolecule metabolic process
GO:1901564	0.977	organonitrogen compound metabolic process
GO:0016311	0.975	dephosphorylation
GO:0048583	0.974	regulation of response to stimulus
GO:0019538	0.974	protein metabolic process
GO:0036211	0.964	protein modification process
GO:0006470	0.949	protein dephosphorylation
GO:0043408	0.933	regulation of MAPK cascade
GO:0043409	0.924	negative regulation of MAPK cascade
GO:0000165	0.915	MAPK cascade
GO:0051338	0.817	regulation of transferase activity
GO:0019222	0.814	regulation of metabolic process
GO:0035335	0.797	peptidyl-tyrosine dephosphorylation
GO:0043549	0.791	regulation of kinase activity
GO:0001932	0.784	regulation of protein phosphorylation
GO:0071900	0.710	regulation of protein serine/threonine kinase activity
GO:0045936	0.673	negative regulation of phosphate metabolic process
GO:0001933	0.663	negative regulation of protein phosphorylation
GO:0043405	0.631	regulation of MAP kinase activity
GO:0070371	0.564	ERK1 and ERK2 cascade
GO:0043407	0.530	negative regulation of MAP kinase activity
GO:0048518	0.440	positive regulation of biological process
GO:0048522	0.363	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]