StarFunc result for job id Q16831

User Input

>input (310 residues)
MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGG
SPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLH
ELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKT
DLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAY
AAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVS
YFIKKKLSKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16831	1.000	1.000	1.131E-67	310	1.000	1.000	Q16831.pdb.gz	UPP1_HUMAN Uridine phosphorylase 1 OS=Homo sapiens OX=9606 GN=UPP1 PE=1 SV=1
2	AFDB:Q499V1	0.950	0.944	1.792E-58	312	0.806	0.801	Q499V1.pdb.gz	Q499V1_RAT Uridine phosphorylase OS=Rattus norvegicus OX=10116 GN=Upp1 PE=2 SV=1
3	PDB:3eueA	0.938	0.985	3.825E-56	295	0.952	1.000	3eueA.pdb.gz	Implications of the structure of human uridine phosphorylase 1 on the development of novel inhibitors for improving the therapeutic window of fluoropyrimidine chemotherapy.
4	AFDB:Q8CGR7	0.957	0.927	2.129E-51	320	0.619	0.600	Q8CGR7.pdb.gz	UPP2_MOUSE Uridine phosphorylase 2 OS=Mus musculus OX=10090 GN=Upp2 PE=1 SV=1
5	AFDB:O95045	0.941	0.920	3.866E-51	317	0.626	0.612	O95045.pdb.gz	UPP2_HUMAN Uridine phosphorylase 2 OS=Homo sapiens OX=9606 GN=UPP2 PE=1 SV=1
6	PDB:3p0fA	0.906	0.958	5.015E-45	293	0.616	0.652	3p0fA.pdb.gz	A novel structural mechanism for redox regulation of uridine phosphorylase 2 activity.
7	AFDB:Q9VBA0	0.927	0.783	3.801E-42	368	0.494	0.416	Q9VBA0.pdb.gz	Q9VBA0_DROME GH09623p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6330 PE=1 SV=2
8	AFDB:Q23588	0.894	0.938	7.176E-38	295	0.426	0.447	Q23588.pdb.gz	UTPP_CAEEL Uridine and thymidine phosphorylase OS=Caenorhabditis elegans OX=6239 GN=upp-1 PE=1 SV=2
9	PDB:4txjB	0.898	0.955	3.168E-37	291	0.400	0.426	4txjB.pdb.gz
10	AFDB:G4VGH9	0.898	0.940	1.186E-36	296	0.365	0.382	G4VGH9.pdb.gz	UPPB_SCHMA Inactive uridine phosphorylase B OS=Schistosoma mansoni OX=6183 GN=UPPB PE=1 SV=1
11	PDB:1u1cA	0.620	0.750	8.871E-17	253	0.203	0.249	1u1cA.pdb.gz	Structural basis for inhibition of Escherichia coli uridine phosphorylase by 5-substituted acyclouridines.
12	AFDB:P12758	0.622	0.752	3.740E-16	253	0.210	0.257	P12758.pdb.gz	UDP_ECOLI Uridine phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=udp PE=1 SV=3
13	PDB:1t0uA	0.521	0.709	5.131E-15	223	0.190	0.265	1t0uA.pdb.gz
14	AFDB:A5K9M4	0.613	0.754	1.264E-14	245	0.161	0.204	A5K9M4.pdb.gz	PNPH_PLAVS Purine nucleoside phosphorylase OS=Plasmodium vivax (strain Salvador I) OX=126793 GN=PNP PE=1 SV=1
15	AFDB:Q54UM3	0.588	0.626	8.535E-14	289	0.184	0.197	Q54UM3.pdb.gz	Q54UM3_DICDI Uridine phosphorylase OS=Dictyostelium discoideum OX=44689 GN=udpB PE=4 SV=1
16	PDB:1a69A	0.540	0.687	1.287E-13	237	0.174	0.228	1a69A.pdb.gz	Crystal structure of the ternary complex of E. coli purine nucleoside phosphorylase with formycin B, a structural analogue of the substrate inosine, and phosphate (Sulphate) at 2.1 A resolution.
17	PDB:3emvA	0.563	0.690	1.366E-13	246	0.165	0.207	3emvA.pdb.gz
18	PDB:3enzC	0.614	0.756	2.634E-13	246	0.145	0.183	3enzC.pdb.gz	Conservation of structure and activity in Plasmodium purine nucleoside phosphorylases.
19	PDB:3bjeA	0.590	0.562	6.073E-13	327	0.203	0.193	3bjeA.pdb.gz	The Crystal Structure and Activity of a Putative Trypanosomal Nucleoside Phosphorylase Reveal It to be a Homodimeric Uridine Phosphorylase
20	PDB:1nc3A	0.568	0.724	7.710E-13	235	0.148	0.196	1nc3A.pdb.gz	Structure of Escherichia coli 5'-methylthioadenosine/ S-adenosylhomocysteine nucleosidase inhibitor complexes provide insight into the conformational changes required for substrate binding and catalysis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F7F0D5	0.0	530	311	0.810	0.807	F7F0D5_RAT Uridine phosphorylase OS=Rattus norvegicus OX=10116 GN=Upp1 PE=1 SV=1
2	P52624	0.0	521	311	0.794	0.791	UPP1_MOUSE Uridine phosphorylase 1 OS=Mus musculus OX=10090 GN=Upp1 PE=1 SV=2
3	Q16831	0.0	641	310	1.000	1.000	UPP1_HUMAN Uridine phosphorylase 1 OS=Homo sapiens OX=9606 GN=UPP1 PE=1 SV=1
4	Q499V1	0.0	528	312	0.806	0.801	Q499V1_RAT Uridine phosphorylase OS=Rattus norvegicus OX=10116 GN=Upp1 PE=2 SV=1
5	O95045	1.22e-139	399	317	0.616	0.603	UPP2_HUMAN Uridine phosphorylase 2 OS=Homo sapiens OX=9606 GN=UPP2 PE=1 SV=1
6	Q8CGR7	1.22e-138	396	320	0.616	0.597	UPP2_MOUSE Uridine phosphorylase 2 OS=Mus musculus OX=10090 GN=Upp2 PE=1 SV=1
7	A0A0S2Z6U5	1.12e-117	342	281	0.526	0.580	A0A0S2Z6U5_HUMAN Uridine phosphorylase OS=Homo sapiens OX=9606 GN=UPP2 PE=1 SV=1
8	Q8IMQ8	1.99e-110	326	347	0.497	0.444	Q8IMQ8_DROME RH29536p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6330 PE=1 SV=1
9	Q9VBA0	2.39e-109	324	368	0.497	0.418	Q9VBA0_DROME GH09623p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6330 PE=1 SV=2
10	C9JIP2	9.05e-107	309	146	0.471	1.000	C9JIP2_HUMAN Uridine phosphorylase 1 (Fragment) OS=Homo sapiens OX=9606 GN=UPP1 PE=1 SV=1
11	C9J486	3.06e-105	305	144	0.465	1.000	C9J486_HUMAN Uridine phosphorylase 1 (Fragment) OS=Homo sapiens OX=9606 GN=UPP1 PE=1 SV=1
12	G4VGI0	6.43e-81	249	296	0.403	0.422	UPPA_SCHMA Uridine phosphorylase A OS=Schistosoma mansoni OX=6183 GN=UPPA PE=1 SV=1
13	G4VGH9	1.20e-74	233	296	0.368	0.385	UPPB_SCHMA Inactive uridine phosphorylase B OS=Schistosoma mansoni OX=6183 GN=UPPB PE=1 SV=1
14	Q23588	1.65e-74	232	295	0.416	0.437	UTPP_CAEEL Uridine and thymidine phosphorylase OS=Caenorhabditis elegans OX=6239 GN=upp-1 PE=1 SV=2
15	P12758	2.20e-09	59.3	253	0.181	0.221	UDP_ECOLI Uridine phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=udp PE=1 SV=3
16	A0A0S2Z639	1.28e-07	50.1	65	0.068	0.323	A0A0S2Z639_HUMAN Uridine phosphorylase 2 isoform 4 OS=Homo sapiens OX=9606 GN=UPP2 PE=1 SV=1
17	Q57VZ2	6.96e-04	43.1	341	0.206	0.188	Q57VZ2_TRYB2 Nucleoside phosphorylase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.830 PE=1 SV=1
18	Q54UM3	0.002	41.6	289	0.165	0.176	Q54UM3_DICDI Uridine phosphorylase OS=Dictyostelium discoideum OX=44689 GN=udpB PE=4 SV=1
19	Q69ZR9	0.71	34.3	1610	0.090	0.017	TASOR_MOUSE Protein TASOR OS=Mus musculus OX=10090 GN=Tasor PE=1 SV=2
20	P0ABP8	1.4	32.7	239	0.103	0.134	DEOD_ECOLI Purine nucleoside phosphorylase DeoD-type OS=Escherichia coli (strain K12) OX=83333 GN=deoD PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01048 PNP_UDP_1	6.8e-25	99.3	Phosphorylase superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330032

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356853	0.983	Uridine-cytidine kinase 2
2	9606.ENSP00000379038	0.982	Thymidine phosphorylase
3	9606.ENSP00000232607	0.980	Uridine 5'-monophosphate synthase
4	9606.ENSP00000359211	0.978	Dihydropyrimidine dehydrogenase [NADP(+)]
5	9606.ENSP00000354532	0.973	Purine nucleoside phosphorylase
6	9606.ENSP00000364212	0.973	Cytidine deaminase
7	9606.ENSP00000361285	0.970	Uridine-cytidine kinase 1
8	9606.ENSP00000362481	0.967	Uracil phosphoribosyltransferase homolog
9	9606.ENSP00000346155	0.964	Uridine-cytidine kinase-like 1
10	9606.ENSP00000299697	0.959	Thymidine kinase 2, mitochondrial
11	9606.ENSP00000301634	0.950	Thymidine kinase, cytosolic
12	9606.ENSP00000301141	0.907	Cytochrome P450 2A6
13	9606.ENSP00000286621	0.839	Adenosine kinase
14	9606.ENSP00000298198	0.822	Glucose 1,6-bisphosphate synthase
15	9606.ENSP00000474090	0.806	Uridine phosphorylase 2
16	9606.ENSP00000373674	0.796	5'(3')-deoxyribonucleotidase, mitochondrial
17	9606.ENSP00000484415	0.786	Cytosolic 5'-nucleotidase 3A
18	9606.ENSP00000217426	0.783	Adenosylhomocysteinase
19	9606.ENSP00000245552	0.774	5'(3')-deoxyribonucleotidase, cytosolic type
20	9606.ENSP00000257770	0.770	5'-nucleotidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004850	1.000	uridine phosphorylase activity
GO:0042802	0.999	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006139	0.995	nucleobase-containing compound metabolic process
GO:0055086	0.992	nucleobase-containing small molecule metabolic process
GO:1901135	0.991	carbohydrate derivative metabolic process
GO:1901564	0.990	organonitrogen compound metabolic process
GO:1901575	0.981	organic substance catabolic process
GO:0072527	0.975	pyrimidine-containing compound metabolic process
GO:0072529	0.961	pyrimidine-containing compound catabolic process
GO:0009116	0.953	nucleoside metabolic process
GO:1901136	0.952	carbohydrate derivative catabolic process
GO:0034655	0.952	nucleobase-containing compound catabolic process
GO:0044282	0.928	small molecule catabolic process
GO:0009164	0.916	nucleoside catabolic process
GO:0042454	0.913	ribonucleoside catabolic process
GO:0009117	0.325	nucleotide metabolic process
GO:0009058	0.307	biosynthetic process
GO:1901576	0.300	organic substance biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.996	organelle
GO:0031981	0.992	nuclear lumen
GO:0005654	0.984	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24388	1.000	phosphate + uridine = alpha-D-ribose 1-phosphate + uracil
EC:2.4.2.3	1.000	uridine phosphorylase.

[back to server]