StarFunc result for job id Q16832

User Input

>input (855 residues)
MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKY
GRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKI
NYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRV
ELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYSMTEGLGQLTDGVSGLD
DFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFK
EVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFS
EITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL
WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPD
YQEPSRLIRKLPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSV
PAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSAN
QPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAVCITDDPLCMITEYMENG
DLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK
NYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWET
FTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP
SFQEIHLLLLQQGDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R906	0.692	0.692	0.000	855	1.000	1.000	A0A024R906.pdb.gz
2	AFDB:Q08345	0.422	0.396	0.000	913	0.552	0.517	Q08345.pdb.gz	DDR1_HUMAN Epithelial discoidin domain-containing receptor 1 OS=Homo sapiens OX=9606 GN=DDR1 PE=1 SV=1
3	AFDB:Q18163	0.377	0.419	1.588E-58	766	0.232	0.258	Q18163.pdb.gz	DDRA_CAEEL Discoidin domain-containing receptor A OS=Caenorhabditis elegans OX=6239 GN=ddr-1 PE=2 SV=3
4	AFDB:F6P1M3	0.318	0.341	2.965E-33	797	0.195	0.210	F6P1M3.pdb.gz	F6P1M3_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=trk PE=3 SV=1
5	AFDB:P04629	0.313	0.336	4.331E-33	796	0.213	0.229	P04629.pdb.gz	NTRK1_HUMAN High affinity nerve growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK1 PE=1 SV=4
6	AFDB:P35739	0.319	0.341	2.319E-32	799	0.212	0.227	P35739.pdb.gz	NTRK1_RAT High affinity nerve growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk1 PE=1 SV=1
7	AFDB:A0A0H2UKW5	0.312	0.328	5.514E-32	813	0.201	0.212	A0A0H2UKW5.pdb.gz	A0A0H2UKW5_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=ntrk3b PE=3 SV=5
8	AFDB:Q9V6K3	0.315	0.370	2.785E-29	724	0.173	0.204	Q9V6K3.pdb.gz	ROR2_DROME Tyrosine-protein kinase transmembrane receptor Ror2 OS=Drosophila melanogaster OX=7227 GN=Nrk PE=1 SV=2
9	AFDB:G5EGK5	0.304	0.281	1.078E-28	928	0.175	0.162	G5EGK5.pdb.gz	CAM1_CAEEL Tyrosine-protein kinase receptor cam-1 OS=Caenorhabditis elegans OX=6239 GN=cam-1 PE=1 SV=1
10	AFDB:P34925	0.302	0.417	2.856E-28	607	0.159	0.224	P34925.pdb.gz	RYK_HUMAN Tyrosine-protein kinase RYK OS=Homo sapiens OX=9606 GN=RYK PE=1 SV=3
11	PDB:2h8hA	0.269	0.489	3.828E-22	445	0.120	0.231	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:4fl2A	0.274	0.411	1.787E-20	555	0.116	0.178	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.266	0.404	1.735E-19	551	0.103	0.160	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:1k9aB	0.259	0.489	7.269E-18	441	0.108	0.209	1k9aB.pdb.gz
15	PDB:4bxsV	0.169	0.117	9.769E-17	1262	0.078	0.053	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
16	PDB:7kveB	0.168	0.107	9.488E-16	1374	0.074	0.046	7kveB.pdb.gz
17	PDB:6s73A	0.257	0.743	6.309E-15	269	0.076	0.242	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
18	PDB:8dksA	0.242	0.665	1.027E-14	283	0.085	0.258	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
19	PDB:4btfA	0.254	0.490	1.966E-14	413	0.070	0.145	4btfA.pdb.gz
20	PDB:2qkwB	0.252	0.653	1.053E-13	292	0.087	0.253	2qkwB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AIV9	0.0	1668	833	0.926	0.951	A0A8I6AIV9_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ddr2 PE=4 SV=1
2	B1WC09	0.0	1692	854	0.953	0.954	B1WC09_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ddr2 PE=4 SV=1
3	Q03146	0.0	856	911	0.547	0.514	DDR1_MOUSE Epithelial discoidin domain-containing receptor 1 OS=Mus musculus OX=10090 GN=Ddr1 PE=2 SV=2
4	Q08345	0.0	856	913	0.553	0.518	DDR1_HUMAN Epithelial discoidin domain-containing receptor 1 OS=Homo sapiens OX=9606 GN=DDR1 PE=1 SV=1
5	Q16832	0.0	1789	855	1.000	1.000	DDR2_HUMAN Discoidin domain-containing receptor 2 OS=Homo sapiens OX=9606 GN=DDR2 PE=1 SV=2
6	Q62371	0.0	1667	854	0.959	0.960	DDR2_MOUSE Discoidin domain-containing receptor 2 OS=Mus musculus OX=10090 GN=Ddr2 PE=1 SV=2
7	Q63474	0.0	855	910	0.550	0.516	DDR1_RAT Epithelial discoidin domain-containing receptor 1 OS=Rattus norvegicus OX=10116 GN=Ddr1 PE=2 SV=1
8	Q95ZV7	3.14e-131	413	797	0.324	0.348	DDRB_CAEEL Discoidin domain-containing receptor tyrosine kinase B OS=Caenorhabditis elegans OX=6239 GN=ddr-2 PE=1 SV=1
9	Q6B515	6.16e-75	259	669	0.164	0.209	Q6B515_TAEGU Tyrosine-protein kinase receptor (Fragment) OS=Taeniopygia guttata OX=59729 PE=2 SV=1
10	P15209	9.33e-75	263	821	0.163	0.169	NTRK2_MOUSE BDNF/NT-3 growth factors receptor OS=Mus musculus OX=10090 GN=Ntrk2 PE=1 SV=1
11	Q63604	1.13e-74	262	821	0.163	0.169	NTRK2_RAT BDNF/NT-3 growth factors receptor OS=Rattus norvegicus OX=10116 GN=Ntrk2 PE=1 SV=1
12	Q91987	2.91e-74	261	818	0.164	0.171	NTRK2_CHICK BDNF/NT-3 growth factors receptor OS=Gallus gallus OX=9031 GN=NTRK2 PE=1 SV=1
13	Q16620	3.60e-74	261	822	0.163	0.169	NTRK2_HUMAN BDNF/NT-3 growth factors receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=1 SV=1
14	Q548C2	3.60e-74	261	822	0.163	0.169	Q548C2_HUMAN Tyrosine-protein kinase receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=2 SV=1
15	F7DGW1	5.23e-74	261	838	0.163	0.166	F7DGW1_MACMU Tyrosine-protein kinase receptor OS=Macaca mulatta OX=9544 GN=NTRK2 PE=2 SV=2
16	Q6VNS1	1.57e-72	256	825	0.164	0.170	NTRK3_MOUSE NT-3 growth factor receptor OS=Mus musculus OX=10090 GN=Ntrk3 PE=1 SV=1
17	Q3UFB7	3.04e-72	255	799	0.160	0.171	NTRK1_MOUSE High affinity nerve growth factor receptor OS=Mus musculus OX=10090 GN=Ntrk1 PE=1 SV=2
18	A0A0R4ILA2	3.71e-72	255	799	0.159	0.170	A0A0R4ILA2_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=si:ch211-220b11.1 PE=3 SV=1
19	F6P1M3	1.22e-71	253	797	0.158	0.169	F6P1M3_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=trk PE=3 SV=1
20	P04629	1.46e-71	253	796	0.158	0.170	NTRK1_HUMAN High affinity nerve growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	2.1e+02	12.4	ABC1 atypical kinase-like domain
2	PF00754 F5_F8_type_C	4.6e-18	77.0	F5/8 type C domain
3	PF12330 Haspin_kinase	1.3e+02	12.9	Haspin like kinase domain
4	PF00069 Pkinase	3.8e-39	146.2	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	1.3e-81	285.3	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356899

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360882	0.805	Collagen alpha-1(V) chain
2	9606.ENSP00000304408	0.799	Collagen alpha-1(III) chain
3	9606.ENSP00000359114	0.742	Collagen alpha-1(XI) chain
4	9606.ENSP00000261405	0.729	Von Willebrand factor
5	9606.ENSP00000052754	0.698	Decorin
6	9606.ENSP00000364979	0.693	Collagen alpha-1(IV) chain
7	9606.ENSP00000381007	0.671	Neuron navigator 3
8	9606.ENSP00000369071	0.655	Periostin
9	9606.ENSP00000225964	0.652	Collagen alpha-1(I) chain
10	9606.ENSP00000296585	0.651	Integrin alpha-2
11	9606.ENSP00000401303	0.648	SHC-transforming protein 1
12	9606.ENSP00000320663	0.645	Echinoderm microtubule-associated protein-like 4
13	9606.ENSP00000263967	0.639	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
14	9606.ENSP00000356903	0.629	UDP-N-acetylhexosamine pyrophosphorylase
15	9606.ENSP00000328088	0.626	PRKC apoptosis WT1 regulator protein
16	9606.ENSP00000261769	0.602	Cadherin-1
17	9606.ENSP00000407586	0.601	GTPase HRas
18	9606.ENSP00000362680	0.589	Proto-oncogene tyrosine-protein kinase Src
19	9606.ENSP00000346839	0.573	Fibronectin type III domain containing
20	9606.ENSP00000256078	0.572	GTPase KRas

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005518	0.999	collagen binding
GO:0004713	0.997	protein tyrosine kinase activity
GO:0004714	0.968	transmembrane receptor protein tyrosine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.984	response to stimulus
GO:0009987	0.982	cellular process
GO:0030334	0.973	regulation of cell migration
GO:0019222	0.964	regulation of metabolic process
GO:0051716	0.957	cellular response to stimulus
GO:0051239	0.955	regulation of multicellular organismal process
GO:2000147	0.947	positive regulation of cell motility
GO:0008152	0.940	metabolic process
GO:0043408	0.938	regulation of MAPK cascade
GO:1903034	0.926	regulation of response to wounding
GO:0030335	0.915	positive regulation of cell migration
GO:0008284	0.910	positive regulation of cell population proliferation
GO:0007154	0.909	cell communication
GO:0070372	0.909	regulation of ERK1 and ERK2 cascade
GO:0032502	0.905	developmental process
GO:0023052	0.902	signaling
GO:0048856	0.901	anatomical structure development
GO:0060255	0.895	regulation of macromolecule metabolic process
GO:0048145	0.888	regulation of fibroblast proliferation
GO:0007165	0.887	signal transduction
GO:0051174	0.868	regulation of phosphorus metabolic process
GO:0032501	0.860	multicellular organismal process
GO:0048660	0.859	regulation of smooth muscle cell proliferation
GO:0042325	0.859	regulation of phosphorylation
GO:0048519	0.847	negative regulation of biological process
GO:0010941	0.847	regulation of cell death
GO:0080090	0.831	regulation of primary metabolic process
GO:0051171	0.828	regulation of nitrogen compound metabolic process
GO:0048523	0.826	negative regulation of cellular process
GO:0007166	0.824	cell surface receptor signaling pathway
GO:0071704	0.820	organic substance metabolic process
GO:0071495	0.817	cellular response to endogenous stimulus
GO:1904705	0.812	regulation of vascular associated smooth muscle cell proliferation
GO:0048661	0.812	positive regulation of smooth muscle cell proliferation
GO:0065009	0.807	regulation of molecular function
GO:0080135	0.806	regulation of cellular response to stress
GO:0010647	0.803	positive regulation of cell communication
GO:0009889	0.797	regulation of biosynthetic process
GO:0006807	0.795	nitrogen compound metabolic process
GO:0044237	0.794	cellular metabolic process
GO:0048146	0.794	positive regulation of fibroblast proliferation
GO:1901990	0.793	regulation of mitotic cell cycle phase transition
GO:0042221	0.792	response to chemical
GO:1903036	0.783	positive regulation of response to wounding
GO:1904707	0.769	positive regulation of vascular associated smooth muscle cell proliferation
GO:0050790	0.768	regulation of catalytic activity
GO:0014910	0.767	regulation of smooth muscle cell migration
GO:1902806	0.766	regulation of cell cycle G1/S phase transition
GO:0009893	0.765	positive regulation of metabolic process
GO:0043410	0.762	positive regulation of MAPK cascade
GO:1901653	0.748	cellular response to peptide
GO:0010712	0.731	regulation of collagen metabolic process
GO:0006950	0.726	response to stress
GO:1902882	0.724	regulation of response to oxidative stress
GO:0044238	0.723	primary metabolic process
GO:0014911	0.714	positive regulation of smooth muscle cell migration
GO:0090068	0.711	positive regulation of cell cycle process
GO:1990776	0.711	response to angiotensin
GO:0061041	0.688	regulation of wound healing
GO:0009628	0.679	response to abiotic stimulus
GO:1903201	0.679	regulation of oxidative stress-induced cell death
GO:1901031	0.676	regulation of response to reactive oxygen species
GO:0045931	0.673	positive regulation of mitotic cell cycle
GO:1901989	0.673	positive regulation of cell cycle phase transition
GO:1901992	0.660	positive regulation of mitotic cell cycle phase transition
GO:2000045	0.645	regulation of G1/S transition of mitotic cell cycle
GO:0071375	0.644	cellular response to peptide hormone stimulus
GO:0051338	0.640	regulation of transferase activity
GO:0043170	0.634	macromolecule metabolic process
GO:1904385	0.633	cellular response to angiotensin
GO:1901564	0.604	organonitrogen compound metabolic process
GO:0009891	0.603	positive regulation of biosynthetic process
GO:0007275	0.601	multicellular organism development
GO:0019538	0.584	protein metabolic process
GO:0007167	0.565	enzyme-linked receptor protein signaling pathway
GO:1902808	0.549	positive regulation of cell cycle G1/S phase transition
GO:0032965	0.546	regulation of collagen biosynthetic process
GO:1900087	0.538	positive regulation of G1/S transition of mitotic cell cycle
GO:0010714	0.536	positive regulation of collagen metabolic process
GO:0010604	0.530	positive regulation of macromolecule metabolic process
GO:0051173	0.526	positive regulation of nitrogen compound metabolic process
GO:0031325	0.525	positive regulation of cellular metabolic process
GO:0036211	0.520	protein modification process
GO:0006793	0.489	phosphorus metabolic process
GO:0071840	0.483	cellular component organization or biogenesis
GO:0016310	0.477	phosphorylation
GO:0051246	0.465	regulation of protein metabolic process
GO:0006468	0.459	protein phosphorylation
GO:0048731	0.450	system development
GO:0010468	0.446	regulation of gene expression
GO:0070848	0.444	response to growth factor
GO:0050793	0.442	regulation of developmental process
GO:0016043	0.435	cellular component organization
GO:0048513	0.434	animal organ development
GO:0009892	0.422	negative regulation of metabolic process
GO:0042981	0.389	regulation of apoptotic process
GO:0043549	0.385	regulation of kinase activity
GO:0009653	0.358	anatomical structure morphogenesis
GO:0051128	0.358	regulation of cellular component organization
GO:0007169	0.334	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0018193	0.331	peptidyl-amino acid modification
GO:0009888	0.308	tissue development
GO:0031326	0.308	regulation of cellular biosynthetic process
GO:0010556	0.307	regulation of macromolecule biosynthetic process
GO:0019219	0.300	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.992	organelle
GO:0043229	0.976	intracellular organelle
GO:0005737	0.852	cytoplasm
GO:0043231	0.828	intracellular membrane-bounded organelle
GO:0043232	0.633	intracellular non-membrane-bounded organelle
GO:0070013	0.435	intracellular organelle lumen
GO:0098590	0.360	plasma membrane region
GO:0005856	0.335	cytoskeleton
GO:0015629	0.300	actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.997	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.1	0.968	receptor protein-tyrosine kinase.

[back to server]