StarFunc result for job id Q16836

User Input

>input (314 residues)
MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTE
DILAKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAI
VENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKL
VEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDAS
KEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAEN
KFGKKTGEGFYKYK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61425	0.999	0.999	1.020E-57	314	0.898	0.898	Q61425.pdb.gz	HCDH_MOUSE Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Hadh PE=1 SV=2
2	PDB:3rqsB	0.998	0.992	1.709E-57	316	0.997	0.991	3rqsB.pdb.gz
3	AFDB:E9PF18	0.998	0.803	2.657E-57	390	0.997	0.803	E9PF18.pdb.gz	E9PF18_HUMAN Hydroxyacyl-CoA dehydrogenase OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=2
4	AFDB:A0A0D9SFP2	0.902	0.891	7.628E-51	318	0.863	0.852	A0A0D9SFP2.pdb.gz	A0A0D9SFP2_HUMAN Hydroxyacyl-CoA dehydrogenase OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=1
5	AFDB:C1BI43	0.933	0.948	1.619E-47	309	0.713	0.725	C1BI43.pdb.gz	C1BI43_ONCMY Short chain 3-hydroxyacyl-CoA dehydrogenase, mitochondrial OS=Oncorhynchus mykiss OX=8022 GN=HCDH PE=2 SV=1
6	AFDB:P9WNP7	0.863	0.945	6.882E-33	286	0.366	0.402	P9WNP7.pdb.gz	FADB2_MYCTU 3-hydroxybutyryl-CoA dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadB2 PE=1 SV=1
7	AFDB:Q9LDF5	0.859	0.915	4.671E-32	294	0.357	0.381	Q9LDF5.pdb.gz	Q9LDF5_ARATH 3-hydroxyacyl-CoA dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g15290 PE=1 SV=1
8	PDB:6hrdA	0.869	0.956	3.025E-31	285	0.366	0.404	6hrdA.pdb.gz
9	AFDB:P76083	0.861	0.576	2.714E-29	475	0.382	0.253	P76083.pdb.gz	PAAH_ECOLI 3-hydroxyadipyl-CoA dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=paaH PE=1 SV=1
10	PDB:3mogC	0.839	0.567	5.698E-29	472	0.379	0.252	3mogC.pdb.gz
11	AFDB:P21177	0.854	0.377	1.259E-26	729	0.334	0.144	P21177.pdb.gz	FADB_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=fadB PE=1 SV=2
12	AFDB:Q8W1L6	0.856	0.378	2.931E-26	726	0.290	0.125	Q8W1L6.pdb.gz	MFP_ORYSJ Peroxisomal fatty acid beta-oxidation multifunctional protein OS=Oryza sativa subsp. japonica OX=39947 GN=MFP PE=1 SV=2
13	AFDB:Q9V397	0.839	0.343	5.147E-26	783	0.318	0.128	Q9V397.pdb.gz	Q9V397_DROME enoyl-CoA hydratase OS=Drosophila melanogaster OX=7227 GN=Mtpalpha PE=1 SV=1
14	PDB:1wdlA	0.842	0.381	2.661E-25	715	0.322	0.141	1wdlA.pdb.gz	Structural basis for channelling mechanism of a fatty acid beta-oxidation multienzyme complex
15	PDB:6ysvA	0.841	0.382	2.153E-23	708	0.350	0.155	6ysvA.pdb.gz
16	PDB:6tnmA	0.841	0.379	2.697E-23	719	0.334	0.146	6tnmA.pdb.gz	Insights into the stability and substrate specificity of the E. coli aerobic beta-oxidation trifunctional enzyme complex.
17	PDB:4b3iA	0.820	0.365	4.001E-23	731	0.318	0.137	4b3iA.pdb.gz	Structure of Mycobacterial Beta-Oxidation Trifunctional Enzyme Reveals its Altered Assembly and Putative Substrate Channeling Pathway.
18	PDB:6dv2G	0.824	0.368	5.302E-23	725	0.309	0.134	6dv2G.pdb.gz
19	PDB:2wtbA	0.795	0.378	1.042E-22	676	0.303	0.141	2wtbA.pdb.gz
20	PDB:3zwaA	0.794	0.357	2.584E-21	727	0.303	0.131	3zwaA.pdb.gz	The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MSE2	0.0	637	317	1.000	0.991	A0A0A0MSE2_HUMAN Hydroxyacyl-CoA dehydrogenase OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=2
2	A0A0D9SFP2	0.0	557	318	0.863	0.852	A0A0D9SFP2_HUMAN Hydroxyacyl-CoA dehydrogenase OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=1
3	A0A140VK76	0.0	642	314	1.000	1.000	A0A140VK76_HUMAN Testis secretory sperm-binding protein Li 203a OS=Homo sapiens OX=9606 PE=2 SV=1
4	A0A1W2PNM1	0.0	530	267	0.847	0.996	A0A1W2PNM1_HUMAN Hydroxyacyl-CoA dehydrogenase (Fragment) OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=1
5	E9PF18	0.0	630	390	1.000	0.805	E9PF18_HUMAN Hydroxyacyl-CoA dehydrogenase OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=2
6	P00348	0.0	587	314	0.927	0.927	HCDH_PIG Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Sus scrofa OX=9823 GN=HADH PE=1 SV=2
7	Q16836	0.0	642	314	1.000	1.000	HCDH_HUMAN Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=3
8	Q61425	0.0	572	314	0.898	0.898	HCDH_MOUSE Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Hadh PE=1 SV=2
9	Q9WVK7	0.0	573	314	0.901	0.901	HCDH_RAT Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hadh PE=2 SV=1
10	C1BI43	6.38e-165	462	309	0.729	0.741	C1BI43_ONCMY Short chain 3-hydroxyacyl-CoA dehydrogenase, mitochondrial OS=Oncorhynchus mykiss OX=8022 GN=HCDH PE=2 SV=1
11	P9WNP7	4.83e-66	211	286	0.379	0.416	FADB2_MYCTU 3-hydroxybutyryl-CoA dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadB2 PE=1 SV=1
12	Q9LDF5	6.13e-65	208	294	0.366	0.391	Q9LDF5_ARATH 3-hydroxyacyl-CoA dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g15290 PE=1 SV=1
13	P76083	2.87e-64	211	475	0.392	0.259	PAAH_ECOLI 3-hydroxyadipyl-CoA dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=paaH PE=1 SV=1
14	P77399	8.59e-46	166	714	0.309	0.136	FADJ_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=fadJ PE=1 SV=1
15	Q9ZPI5	4.49e-44	162	725	0.334	0.145	MFP2_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 OS=Arabidopsis thaliana OX=3702 GN=MFP2 PE=1 SV=1
16	Q9V397	2.26e-43	160	783	0.315	0.126	Q9V397_DROME enoyl-CoA hydratase OS=Drosophila melanogaster OX=7227 GN=Mtpalpha PE=1 SV=1
17	Q8IPE8	2.52e-43	160	744	0.315	0.133	Q8IPE8_DROME enoyl-CoA hydratase OS=Drosophila melanogaster OX=7227 GN=Mtpalpha PE=1 SV=1
18	A0A2R8Y4F5	3.12e-43	159	728	0.312	0.135	A0A2R8Y4F5_HUMAN enoyl-CoA hydratase OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=1
19	E9KL44	3.62e-43	159	763	0.312	0.128	E9KL44_HUMAN enoyl-CoA hydratase OS=Homo sapiens OX=9606 PE=2 SV=1
20	P40939	3.62e-43	159	763	0.312	0.128	ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	55	14.5	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF00725 3HCDH	1.3e-30	117.1	3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
3	PF02737 3HCDH_N	4.6e-60	214.1	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
4	PF01262 AlaDh_PNT_C	21	15.9	Alanine dehydrogenase/PNT, C-terminal domain
5	PF01266 DAO	7.7	17.6	FAD dependent oxidoreductase
6	PF03807 F420_oxidored	29	16.7	NADP oxidoreductase coenzyme F420-dependent
7	PF12831 FAD_oxidored	5.9e+02	11.1	FAD dependent oxidoreductase
8	PF01134 GIDA	35	15.0	Glucose inhibited division protein A
9	PF03446 NAD_binding_2	1.8	20.2	NAD binding domain of 6-phosphogluconate dehydrogenase
10	PF13241 NAD_binding_7	7.9	18.3	Putative NAD(P)-binding
11	PF13450 NAD_binding_8	80	14.9	NAD(P)-binding Rossmann-like domain
12	PF01210 NAD_Gly3P_dh_N	1.1	20.6	NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
13	PF00070 Pyr_redox	0.52	22.2	Pyridine nucleotide-disulphide oxidoreductase
14	PF07992 Pyr_redox_2	0.024	25.5	Pyridine nucleotide-disulphide oxidoreductase
15	PF03435 Sacchrp_dh_NADP	3.1e+02	13.0	Saccharopine dehydrogenase NADP binding domain
16	PF03721 UDPG_MGDP_dh_N	0.38	21.8	UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain
17	PF13478 XdhC_C	3.3e+02	13.2	XdhC Rossmann domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015739

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000002477	0.999	Uncharacterized protein
2	61853.ENSNLEP00000002759	0.999	Enoyl CoA hydratase, short chain, 1, mitochondrial
3	61853.ENSNLEP00000014103	0.999	acetyl-CoA acyltransferase 2
4	61853.ENSNLEP00000008812	0.993	acetyl-CoA acetyltransferase 1
5	61853.ENSNLEP00000013566	0.993	acetyl-CoA acetyltransferase 2
6	61853.ENSNLEP00000017191	0.992	Ethylmalonyl-CoA decarboxylase 1
7	61853.ENSNLEP00000002082	0.991	Uncharacterized protein
8	61853.ENSNLEP00000006441	0.991	acetyl-CoA acyltransferase 1
9	61853.ENSNLEP00000007846	0.991	enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
10	61853.ENSNLEP00000008092	0.990	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial
11	61853.ENSNLEP00000019299	0.975	acyl-CoA dehydrogenase, C-2 to C-3 short chain
12	61853.ENSNLEP00000021860	0.975	Enoyl CoA hydratase domain containing 2
13	61853.ENSNLEP00000011323	0.974	enoyl-CoA delta isomerase 1
14	61853.ENSNLEP00000021859	0.974	Sterol carrier protein 2
15	61853.ENSNLEP00000020390	0.972	Enoyl CoA hydratase 1, peroxisomal
16	61853.ENSNLEP00000000532	0.971	AU RNA binding protein/enoyl-CoA hydratase
17	61853.ENSNLEP00000019640	0.970	Aldehyde dehydrogenase 6 family, member A1
18	61853.ENSNLEP00000018248	0.947	3-hydroxyisobutyrate dehydrogenase
19	61853.ENSNLEP00000024227	0.944	4-aminobutyrate aminotransferase
20	61853.ENSNLEP00000004840	0.936	Propionyl CoA carboxylase, beta polypeptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003857	0.999	3-hydroxyacyl-CoA dehydrogenase activity
GO:0005515	0.995	protein binding
GO:0036094	0.717	small molecule binding
GO:1901363	0.701	heterocyclic compound binding
GO:0097159	0.701	organic cyclic compound binding
GO:1901265	0.588	nucleoside phosphate binding
GO:0000166	0.580	nucleotide binding
GO:0043167	0.576	ion binding
GO:0051287	0.449	NAD binding
GO:0043168	0.406	anion binding
GO:0070403	0.369	NAD+ binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0044281	0.988	small molecule metabolic process
GO:0006631	0.984	fatty acid metabolic process
GO:0016042	0.980	lipid catabolic process
GO:0030258	0.975	lipid modification
GO:0006635	0.970	fatty acid beta-oxidation
GO:0065007	0.369	biological regulation
GO:0050789	0.327	regulation of biological process
GO:0050794	0.310	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.999	intracellular organelle lumen
GO:0005739	0.999	mitochondrion
GO:0005634	0.998	nucleus
GO:0031981	0.991	nuclear lumen
GO:0005654	0.981	nucleoplasm
GO:0005759	0.852	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22432	0.999	a (3S)-3-hydroxyacyl-CoA + NAD(+) = a 3-oxoacyl-CoA + H(+) + NADH
EC:1.1.1.35	0.999	3-hydroxyacyl-CoA dehydrogenase.

[back to server]