StarFunc result for job id Q16842

User Input

>input (350 residues)
MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRL
SKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFK
SHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMN
QAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTY
APVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFG
ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q11204	0.943	0.943	1.310E-72	350	0.943	0.943	Q11204.pdb.gz	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
2	AFDB:Q02745	0.797	0.813	6.443E-46	343	0.463	0.472	Q02745.pdb.gz	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
3	AFDB:Q11201	0.805	0.829	2.738E-45	340	0.471	0.485	Q11201.pdb.gz	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
4	AFDB:P54751	0.803	0.834	4.529E-45	337	0.466	0.484	P54751.pdb.gz	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
5	AFDB:Q9UJ37	0.659	0.621	8.897E-23	374	0.266	0.249	Q9UJ37.pdb.gz	SIA7B_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GALNAC2 PE=1 SV=1
6	AFDB:P61131	0.631	0.661	2.496E-21	333	0.234	0.246	P61131.pdb.gz	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
7	PDB:6aplC	0.634	0.717	7.051E-21	306	0.223	0.255	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
8	AFDB:Q92183	0.649	0.417	7.272E-21	566	0.229	0.141	Q92183.pdb.gz	SIA7A_CHICK Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Gallus gallus OX=9031 GN=ST6GALNAC1 PE=1 SV=1
9	AFDB:Q7T2X4	0.641	0.513	9.005E-20	446	0.249	0.195	Q7T2X4.pdb.gz	Q7T2X4_ONCMY GalNAc alpha 2,6-sialyltransferase OS=Oncorhynchus mykiss OX=8022 GN=rtST6GalNAc PE=2 SV=1
10	AFDB:Q11203	0.622	0.584	1.313E-19	375	0.254	0.237	Q11203.pdb.gz	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
11	AFDB:Q6EV30	0.602	0.553	2.314E-19	383	0.251	0.230	Q6EV30.pdb.gz
12	PDB:7pt62	0.091	0.059	3.220E-2	629	0.049	0.027	7pt62.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
13	PDB:6rqcA	0.091	0.075	5.327E-2	494	0.080	0.057	6rqcA.pdb.gz	Mechanism of head-to-head MCM double-hexamer formation revealed by cryo-EM.
14	PDB:6wgg2	0.093	0.070	7.769E-2	581	0.063	0.038	6wgg2.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
15	PDB:4tmkA	0.183	0.252	1.207E-1	210	0.077	0.129	4tmkA.pdb.gz	Structural basis for efficient phosphorylation of 3'-azidothymidine monophosphate by Escherichia coli thymidylate kinase.
16	PDB:6xtx2	0.112	0.068	1.457E-1	691	0.049	0.025	6xtx2.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
17	PDB:5lb9A	0.133	0.129	1.552E-1	365	0.060	0.058	5lb9A.pdb.gz	A conserved threonine prevents self-intoxication of enoyl-thioester reductases.
18	PDB:6xtx6	0.115	0.071	1.552E-1	679	0.103	0.053	6xtx6.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
19	PDB:5v8f3	0.118	0.077	1.760E-1	654	0.094	0.050	5v8f3.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
20	PDB:7pt63	0.118	0.081	1.874E-1	637	0.089	0.049	7pt63.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q11204	0.0	702	350	0.943	0.943	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
2	Q11205	0.0	699	350	0.937	0.937	SIA4B_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Rattus norvegicus OX=10116 GN=St3gal2 PE=1 SV=1
3	Q16842	0.0	738	350	1.000	1.000	SIA4B_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST3GAL2 PE=1 SV=1
4	Q11201	1.32e-123	360	340	0.489	0.503	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
5	Q02745	3.68e-120	352	343	0.460	0.469	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
6	P54751	2.36e-111	329	337	0.434	0.451	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
7	Q08BF4	4.08e-29	117	382	0.226	0.207	Q08BF4_DANRE ST3 beta-galactoside alpha-2,3-sialyltransferase 5, like OS=Danio rerio OX=7955 GN=zgc:153853 PE=2 SV=1
8	Q91Y74	2.71e-27	111	333	0.197	0.207	SIA4C_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Mus musculus OX=10090 GN=St3gal4 PE=1 SV=1
9	Q11206	3.46e-27	111	333	0.191	0.201	SIA4C_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Homo sapiens OX=9606 GN=ST3GAL4 PE=1 SV=1
10	P61131	6.30e-26	108	333	0.191	0.201	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
11	Q11203	7.03e-26	108	375	0.223	0.208	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
12	P97325	1.28e-25	107	374	0.223	0.209	SIAT6_MOUSE CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Mus musculus OX=10090 GN=St3gal3 PE=1 SV=2
13	Q02734	1.14e-24	105	374	0.220	0.206	SIAT6_RAT CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1
14	Q9UNP4	3.22e-22	99.0	418	0.249	0.208	SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL5 PE=1 SV=4
15	Q7T2X4	5.52e-22	98.6	446	0.211	0.166	Q7T2X4_ONCMY GalNAc alpha 2,6-sialyltransferase OS=Oncorhynchus mykiss OX=8022 GN=rtST6GalNAc PE=2 SV=1
16	Q9UJ37	7.10e-22	97.4	374	0.286	0.267	SIA7B_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GALNAC2 PE=1 SV=1
17	Q9Y274	6.71e-20	91.3	331	0.166	0.175	SIA10_HUMAN Type 2 lactosamine alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL6 PE=1 SV=1
18	Q8QH83	9.88e-19	88.6	381	0.220	0.202	Q8QH83_DANRE Alpha-2,8-sialyltransferase 8B OS=Danio rerio OX=7955 GN=siat8 PE=2 SV=1
19	Q9H4F1	1.19e-18	87.0	302	0.191	0.222	SIA7D_HUMAN Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase OS=Homo sapiens OX=9606 GN=ST6GALNAC4 PE=2 SV=2
20	Q64690	9.02e-17	82.4	359	0.191	0.187	SIA8D_CRIGR CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Cricetulus griseus OX=10029 GN=ST8SIA4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20594 DUF6794	4.9e+02	12.2	Domain of unknown function (DUF6794)
2	PF00777 Glyco_transf_29	7.5e-77	270.1	Glycosyltransferase family 29 (sialyltransferase)
3	PF01019 G_glu_transpept	14	16.0	Gamma-glutamyltranspeptidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377257

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000390784	0.977	Beta-1,3-galactosyltransferase 4
2	9606.ENSP00000306920	0.954	Beta-galactosidase
3	9606.ENSP00000389176	0.947	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
4	9606.ENSP00000415454	0.946	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
5	9606.ENSP00000312021	0.944	Galactoside 2-alpha-L-fucosyltransferase 1
6	9606.ENSP00000304364	0.938	C1GALT1-specific chaperone 1
7	9606.ENSP00000381699	0.934	Beta-1,3-galactosyltransferase 5
8	9606.ENSP00000387498	0.931	Galactoside 2-alpha-L-fucosyltransferase 2
9	9606.ENSP00000379353	0.930	Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
10	9606.ENSP00000379377	0.930	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
11	9606.ENSP00000321343	0.924	Alpha-2,8-sialyltransferase 8E
12	9606.ENSP00000329214	0.923	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
13	9606.ENSP00000362235	0.923	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
14	9606.ENSP00000156626	0.922	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
15	9606.ENSP00000336733	0.922	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
16	9606.ENSP00000317027	0.921	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4
17	9606.ENSP00000381008	0.917	Mucin-16
18	9606.ENSP00000417583	0.916	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
19	9606.ENSP00000484824	0.916	Mucin-1
20	9606.ENSP00000414350	0.911	Mucin-20

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0003836	0.950	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity
GO:0005515	0.414	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:1901135	0.995	carbohydrate derivative metabolic process
GO:1901576	0.995	organic substance biosynthetic process
GO:0043412	0.995	macromolecule modification
GO:0044249	0.995	cellular biosynthetic process
GO:0044260	0.995	cellular macromolecule metabolic process
GO:0006486	0.992	protein glycosylation
GO:0044255	0.985	cellular lipid metabolic process
GO:0006643	0.982	membrane lipid metabolic process
GO:0043603	0.967	amide metabolic process
GO:0046513	0.950	ceramide biosynthetic process
GO:0006688	0.945	glycosphingolipid biosynthetic process
GO:0001573	0.348	ganglioside metabolic process
GO:0006493	0.325	protein O-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:21616	0.950	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+)
EC:2.4.99.4	0.950	Transferred entry: 2.4.3.4.

[back to server]