StarFunc result for job id Q16849

User Input

>input (979 residues)
MRRPRRPGGLGGSGGLRLLLCLLLLSSRPGGCSAVSAHGCLFDRRLCSHLEVCIQDGLFG
QCQVGVGQARPLLQVTSPVLQRLQGVLRQLMSQGLSWHDDLTQYVISQEMERIPRLRPPE
PRPRDRSGLAPKRPGPAGELLLQDIPTGSAPAAQHRLPQPPVGKGGAGASSSLSPLQAEL
LPPLLEHLLLPPQPPHPSLSYEPALLQPYLFHQFGSRDGSRVSEGSPGMVSVGPLPKAEA
PALFSRTASKGIFGDHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQG
SSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTL
LTLLQLLPKGAGRNPGGVVNVGADIKKTMEGPVEGRDTAELPARTSPMPGHPTASPTSSE
VQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKP
LSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSE
LEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMRSVLLTLVALAGVAGLLVALAVALCV
RQHARQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQ
FSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQ
AEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAY
IATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLV
SEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRG
RSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFE
FALTAVAEEVNAILKALPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16849	1.000	1.000	0.000	979	1.000	1.000	Q16849.pdb.gz	PTPRN_HUMAN Receptor-type tyrosine-protein phosphatase-like N OS=Homo sapiens OX=9606 GN=PTPRN PE=1 SV=1
2	AFDB:Q63259	0.550	0.548	0.000	983	0.874	0.871	Q63259.pdb.gz	PTPRN_RAT Receptor-type tyrosine-protein phosphatase-like N OS=Rattus norvegicus OX=10116 GN=Ptprn PE=1 SV=2
3	AFDB:Q9Y4I9	0.320	0.318	1.108E-75	986	0.439	0.436	Q9Y4I9.pdb.gz	Q9Y4I9_HUMAN Tyrosine phosphatase IA-2beta OS=Homo sapiens OX=9606 PE=2 SV=1
4	AFDB:P23471	0.268	0.116	4.032E-26	2315	0.178	0.075	P23471.pdb.gz	PTPRZ_HUMAN Receptor-type tyrosine-protein phosphatase zeta OS=Homo sapiens OX=9606 GN=PTPRZ1 PE=1 SV=4
5	PDB:5xzrA	0.267	0.496	1.668E-25	519	0.107	0.202	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
6	AFDB:Q62656	0.267	0.115	2.096E-25	2316	0.197	0.083	Q62656.pdb.gz	PTPRZ_RAT Receptor-type tyrosine-protein phosphatase zeta OS=Rattus norvegicus OX=10116 GN=Ptprz1 PE=1 SV=1
7	PDB:4gwfA	0.267	0.516	2.588E-25	497	0.102	0.201	4gwfA.pdb.gz
8	AFDB:Q16825	0.271	0.227	1.151E-24	1174	0.178	0.148	Q16825.pdb.gz	PTN21_HUMAN Tyrosine-protein phosphatase non-receptor type 21 OS=Homo sapiens OX=9606 GN=PTPN21 PE=1 SV=2
9	PDB:6krwA	0.290	0.892	1.587E-24	306	0.092	0.294	6krwA.pdb.gz
10	PDB:3ps5A	0.261	0.474	5.314E-24	529	0.104	0.193	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
11	AFDB:D4A2D5	0.276	0.334	1.068E-17	804	0.105	0.128	D4A2D5.pdb.gz	D4A2D5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn22 PE=1 SV=1
12	AFDB:Q05209	0.271	0.338	2.436E-17	780	0.104	0.131	Q05209.pdb.gz	PTN12_HUMAN Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12 PE=1 SV=3
13	PDB:3m4uA	0.245	0.803	4.693E-16	285	0.074	0.253	3m4uA.pdb.gz
14	AFDB:Q9W2F3	0.235	0.171	6.682E-13	1377	0.165	0.118	Q9W2F3.pdb.gz	Q9W2F3_DROME Protein tyrosine phosphatase ERK OS=Drosophila melanogaster OX=7227 GN=PTP-ER PE=2 SV=2
15	PDB:3s4oA	0.116	0.547	1.201E-3	163	0.032	0.190	3s4oA.pdb.gz
16	PDB:4ercA	0.117	0.635	3.229E-3	150	0.031	0.200	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
17	PDB:5xjvB	0.119	0.546	4.250E-3	171	0.023	0.135	5xjvB.pdb.gz
18	PDB:5bx1A	0.115	0.603	9.690E-3	153	0.037	0.235	5bx1A.pdb.gz	Crystal Structure of PRL-1 complex with compound analogy 3
19	PDB:2gwoC	0.119	0.514	1.423E-2	174	0.022	0.126	2gwoC.pdb.gz
20	AFDB:O74360	0.041	0.042	3.458E-2	933	0.102	0.107	O74360.pdb.gz	RGA4_SCHPO Probable Rho-type GTPase-activating protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga4 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P80560	0.0	659	1001	0.339	0.332	PTPR2_MOUSE Receptor-type tyrosine-protein phosphatase N2 OS=Mus musculus OX=10090 GN=Ptprn2 PE=1 SV=2
2	Q16849	0.0	1986	979	1.000	1.000	PTPRN_HUMAN Receptor-type tyrosine-protein phosphatase-like N OS=Homo sapiens OX=9606 GN=PTPRN PE=1 SV=1
3	Q60673	0.0	1568	979	0.849	0.849	PTPRN_MOUSE Receptor-type tyrosine-protein phosphatase-like N OS=Mus musculus OX=10090 GN=Ptprn PE=1 SV=2
4	Q63259	0.0	1603	983	0.874	0.871	PTPRN_RAT Receptor-type tyrosine-protein phosphatase-like N OS=Rattus norvegicus OX=10116 GN=Ptprn PE=1 SV=2
5	Q63475	0.0	649	1004	0.334	0.326	PTPR2_RAT Receptor-type tyrosine-protein phosphatase N2 OS=Rattus norvegicus OX=10116 GN=Ptprn2 PE=1 SV=1
6	Q92932	0.0	663	1015	0.344	0.332	PTPR2_HUMAN Receptor-type tyrosine-protein phosphatase N2 OS=Homo sapiens OX=9606 GN=PTPRN2 PE=1 SV=2
7	Q9Y4I9	0.0	634	986	0.336	0.334	Q9Y4I9_HUMAN Tyrosine phosphatase IA-2beta OS=Homo sapiens OX=9606 PE=2 SV=1
8	Q8MQR5	4.02e-144	447	686	0.260	0.372	Q8MQR5_DROME GH26549p (Fragment) OS=Drosophila melanogaster OX=7227 GN=IA-2 PE=2 SV=1
9	Q7YTY8	6.61e-138	447	1287	0.257	0.196	Q7YTY8_DROME GH05223p OS=Drosophila melanogaster OX=7227 GN=IA-2 PE=2 SV=1
10	Q59E11	7.76e-138	447	1306	0.257	0.193	Q59E11_DROME IA-2 protein tyrosine phosphatase, isoform D OS=Drosophila melanogaster OX=7227 GN=IA-2 PE=1 SV=2
11	Q9VPV8	8.14e-138	448	1319	0.257	0.191	Q9VPV8_DROME IA-2 protein tyrosine phosphatase, isoform C OS=Drosophila melanogaster OX=7227 GN=IA-2 PE=1 SV=4
12	M9PAZ4	1.48e-137	447	1318	0.257	0.191	M9PAZ4_DROME IA-2 protein tyrosine phosphatase, isoform E OS=Drosophila melanogaster OX=7227 GN=IA-2 PE=1 SV=1
13	Q9BKN7	4.34e-131	404	429	0.192	0.438	Q9BKN7_DROME IA2 (Fragment) OS=Drosophila melanogaster OX=7227 GN=IA-2 PE=2 SV=1
14	G5EGJ5	2.75e-92	312	767	0.172	0.219	IDA1_CAEEL Receptor-type tyrosine-protein phosphatase-like ida-1 OS=Caenorhabditis elegans OX=6239 GN=ida-1 PE=1 SV=1
15	F1NWE3	3.31e-50	196	1516	0.128	0.082	PTPRS_CHICK Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3
16	Q8IRM6	1.78e-49	185	498	0.112	0.221	Q8IRM6_DROME Protein tyrosine phosphatase Meg2, isoform D OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1
17	B9EKR1	5.02e-49	192	2312	0.104	0.044	PTPRZ_MOUSE Receptor-type tyrosine-protein phosphatase zeta OS=Mus musculus OX=10090 GN=Ptprz1 PE=1 SV=1
18	Q62656	7.45e-49	192	2316	0.103	0.044	PTPRZ_RAT Receptor-type tyrosine-protein phosphatase zeta OS=Rattus norvegicus OX=10116 GN=Ptprz1 PE=1 SV=1
19	Q59E68	7.46e-49	186	597	0.112	0.184	Q59E68_DROME Protein tyrosine phosphatase Meg2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1
20	Q63745	8.07e-49	180	382	0.098	0.251	Q63745_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	1.7e+02	13.4	Dual specificity phosphatase, catalytic domain
2	PF11548 Receptor_IA-2	1.5e-28	109.9	Protein-tyrosine phosphatase receptor IA-2
3	PF14948 RESP18	4.6e-29	112.0	RESP18 domain
4	PF00102 Y_phosphatase	3.8e-70	247.7	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295718

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000338191	0.976	Beta-2-syntrophin
2	9606.ENSP00000365437	0.942	Glutamate decarboxylase 2
3	9606.ENSP00000312631	0.940	Insulinoma-associated protein 1
4	9606.ENSP00000355893	0.911	Zinc transporter 10
5	9606.ENSP00000374069	0.885	Receptor-type tyrosine-protein phosphatase N2
6	9606.ENSP00000415011	0.880	Zinc transporter 8
7	9606.ENSP00000380432	0.845	Insulin
8	9606.ENSP00000306523	0.833	Insulinoma-associated protein 2
9	9606.ENSP00000221132	0.782	Tumor necrosis factor receptor superfamily member 10A
10	9606.ENSP00000481006	0.751	Myelin proteolipid protein
11	9606.ENSP00000241014	0.749	C-Jun-amino-terminal kinase-interacting protein 1
12	9606.ENSP00000263373	0.723	Spectrin beta chain, non-erythrocytic 4
13	9606.ENSP00000293328	0.708	Signal transducer and activator of transcription 5B
14	9606.ENSP00000367013	0.693	Tumor necrosis factor receptor superfamily member 25
15	9606.ENSP00000364512	0.685	Glucose-6-phosphatase 2
16	9606.ENSP00000345719	0.681	Torsin-1A
17	9606.ENSP00000262545	0.679	Neuroendocrine convertase 2
18	9606.ENSP00000346599	0.671	Serine/threonine/tyrosine-interacting protein
19	9606.ENSP00000300175	0.665	Neuroendocrine protein 7B2
20	9606.ENSP00000255764	0.656	Mediator of RNA polymerase II transcription subunit 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016791	0.938	phosphatase activity
GO:0004721	0.903	phosphoprotein phosphatase activity
GO:0004725	0.834	protein tyrosine phosphatase activity
GO:0019899	0.801	enzyme binding
GO:0044877	0.514	protein-containing complex binding
GO:0008092	0.500	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0065007	0.985	biological regulation
GO:0050794	0.976	regulation of cellular process
GO:0048518	0.950	positive regulation of biological process
GO:0050896	0.937	response to stimulus
GO:0046879	0.930	hormone secretion
GO:0015833	0.929	peptide transport
GO:0071692	0.925	protein localization to extracellular region
GO:0032502	0.897	developmental process
GO:0030072	0.892	peptide hormone secretion
GO:0048856	0.887	anatomical structure development
GO:0009306	0.886	protein secretion
GO:0030073	0.877	insulin secretion
GO:0032501	0.868	multicellular organismal process
GO:0051716	0.868	cellular response to stimulus
GO:0048522	0.801	positive regulation of cellular process
GO:0042221	0.796	response to chemical
GO:1901700	0.787	response to oxygen-containing compound
GO:0010033	0.786	response to organic substance
GO:0009749	0.748	response to glucose
GO:0050678	0.727	regulation of epithelial cell proliferation
GO:0042592	0.679	homeostatic process
GO:0007165	0.664	signal transduction
GO:0070887	0.598	cellular response to chemical stimulus
GO:0008152	0.456	metabolic process
GO:0071310	0.451	cellular response to organic substance
GO:0071704	0.380	organic substance metabolic process
GO:0071840	0.364	cellular component organization or biogenesis
GO:0044237	0.351	cellular metabolic process
GO:0050679	0.341	positive regulation of epithelial cell proliferation
GO:0016043	0.330	cellular component organization
GO:0044238	0.313	primary metabolic process
GO:0048519	0.310	negative regulation of biological process
GO:0019222	0.307	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0016020	0.992	membrane
GO:0005737	0.990	cytoplasm
GO:0071944	0.957	cell periphery
GO:0005886	0.952	plasma membrane
GO:0005634	0.952	nucleus
GO:0031982	0.908	vesicle
GO:0097708	0.754	intracellular vesicle
GO:0031410	0.685	cytoplasmic vesicle
GO:0030054	0.552	cell junction
GO:0070013	0.542	intracellular organelle lumen
GO:0042995	0.395	cell projection
GO:0120025	0.393	plasma membrane bounded cell projection
GO:0043005	0.375	neuron projection
GO:0045202	0.337	synapse
GO:0098793	0.327	presynapse
GO:0005654	0.300	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	0.938	Phosphoric monoester hydrolases.
RHEA:10684	0.834	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.834	protein-tyrosine-phosphatase.

[back to server]