StarFunc result for job id Q16854

User Input

>input (277 residues)
MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIAVGKSTFVKLLTK
TYPEWHVATEPVATWQNIQAAGTQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLK
VQLEPFPEKLLQARKPVQIFERSVYSDRYIFAKNLFENGSLSDIEWHIYQDWHSFLLWEF
ASRITLHGFIYLQASPQVCLKRLYQRAREEEKGIELAYLEQLHGQHEAWLIHKTTKLHFE
ALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16854	1.000	1.000	3.760E-50	277	1.000	1.000	Q16854.pdb.gz	DGUOK_HUMAN Deoxyguanosine kinase, mitochondrial OS=Homo sapiens OX=9606 GN=DGUOK PE=1 SV=2
2	AFDB:Q9QX60	0.881	0.881	5.401E-40	277	0.751	0.751	Q9QX60.pdb.gz	DGUOK_MOUSE Deoxyguanosine kinase, mitochondrial OS=Mus musculus OX=10090 GN=Dguok PE=1 SV=3
3	AFDB:A0A0G2K478	0.881	0.881	8.525E-40	277	0.751	0.751	A0A0G2K478.pdb.gz	A0A0G2K478_RAT Deoxyguanosine kinase OS=Rattus norvegicus OX=10116 GN=Dguok PE=4 SV=2
4	AFDB:D3ZDE4	0.846	0.843	2.868E-37	278	0.729	0.727	D3ZDE4.pdb.gz	D3ZDE4_RAT Deoxyguanosine kinase OS=Rattus norvegicus OX=10116 GN=Dguok PE=3 SV=1
5	AFDB:Q5ZJM7	0.843	0.880	5.020E-31	265	0.487	0.509	Q5ZJM7.pdb.gz	DCK2_CHICK Deoxycytidine kinase 2 OS=Gallus gallus OX=9031 GN=DCK2 PE=1 SV=1
6	AFDB:Q6DD33	0.847	0.888	1.974E-30	264	0.466	0.489	Q6DD33.pdb.gz	DCK2_XENLA Deoxycytidine kinase 2 OS=Xenopus laevis OX=8355 GN=dck.2 PE=1 SV=1
7	AFDB:Q6GPW6	0.827	0.864	7.329E-30	265	0.487	0.509	Q6GPW6.pdb.gz	DGUOK_XENLA Deoxyguanosine kinase, mitochondrial OS=Xenopus laevis OX=8355 GN=dguok PE=1 SV=1
8	AFDB:A0A1L8HV70	0.842	0.879	2.722E-29	265	0.458	0.479	A0A1L8HV70.pdb.gz	DCK1_XENLA Deoxycytidine kinase 1 OS=Xenopus laevis OX=8355 GN=dck.1.L PE=1 SV=1
9	AFDB:P48769	0.827	0.879	9.547E-29	260	0.448	0.477	P48769.pdb.gz	DCK_RAT Deoxycytidine kinase OS=Rattus norvegicus OX=10116 GN=Dck PE=1 SV=1
10	AFDB:Q5ZMF3	0.844	0.908	3.349E-28	257	0.415	0.447	Q5ZMF3.pdb.gz	DCK_CHICK Deoxycytidine kinase OS=Gallus gallus OX=9031 GN=DCK PE=1 SV=1
11	PDB:2no0A	0.824	0.940	1.889E-27	242	0.437	0.500	2no0A.pdb.gz	Nonenantioselectivity Property of Human Deoxycytidine Kinase Explained by Structures of the Enzyme in Complex with l- and d-Nucleosides.
12	PDB:2a2zB	0.764	0.954	6.977E-24	221	0.419	0.525	2a2zB.pdb.gz	Structural basis for the preference of UTP over ATP in human deoxycytidine kinase: illuminating the role of main-chain reorganization.
13	PDB:2vp4D	0.641	0.879	1.029E-17	199	0.274	0.382	2vp4D.pdb.gz	Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
14	PDB:7ak5O	0.614	0.538	1.565E-7	320	0.170	0.147	7ak5O.pdb.gz	Structural basis for a complex I mutation that blocks pathological ROS production.
15	PDB:7qsdO	0.584	0.513	7.301E-7	320	0.166	0.144	7qsdO.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.
16	PDB:4tmkA	0.517	0.653	8.014E-6	210	0.126	0.167	4tmkA.pdb.gz	Structural basis for efficient phosphorylation of 3'-azidothymidine monophosphate by Escherichia coli thymidylate kinase.
17	PDB:3tmkA	0.441	0.540	9.510E-6	216	0.137	0.176	3tmkA.pdb.gz	Crystal structure of yeast thymidylate kinase complexed with the bisubstrate inhibitor P1-(5'-adenosyl) P5-(5'-thymidyl) pentaphosphate (TP5A) at 2.0 A resolution: implications for catalysis and AZT activation.
18	PDB:5nrnB	0.450	0.562	2.976E-5	211	0.134	0.175	5nrnB.pdb.gz	Mtb TMK crystal structure in complex with compound LS3080
19	PDB:2p0eA	0.356	0.484	4.437E-5	190	0.134	0.195	2p0eA.pdb.gz	Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
20	PDB:2wwfC	0.416	0.522	5.265E-5	212	0.119	0.156	2wwfC.pdb.gz	Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16854	0.0	576	277	1.000	1.000	DGUOK_HUMAN Deoxyguanosine kinase, mitochondrial OS=Homo sapiens OX=9606 GN=DGUOK PE=1 SV=2
2	Q9QX60	4.78e-157	440	277	0.751	0.751	DGUOK_MOUSE Deoxyguanosine kinase, mitochondrial OS=Mus musculus OX=10090 GN=Dguok PE=1 SV=3
3	D3ZDE4	2.42e-153	431	278	0.729	0.727	D3ZDE4_RAT Deoxyguanosine kinase OS=Rattus norvegicus OX=10116 GN=Dguok PE=3 SV=1
4	A0A8I5ZV32	2.55e-153	432	309	0.733	0.657	A0A8I5ZV32_RAT Deoxyguanosine kinase OS=Rattus norvegicus OX=10116 GN=Dguok PE=1 SV=1
5	A0A0G2K478	8.98e-141	401	333	0.736	0.613	A0A0G2K478_RAT Deoxyguanosine kinase OS=Rattus norvegicus OX=10116 GN=Dguok PE=4 SV=2
6	B5DEP0	9.90e-104	301	180	0.505	0.778	B5DEP0_RAT Dguok protein OS=Rattus norvegicus OX=10116 GN=Dguok PE=2 SV=1
7	Q5ZJM7	2.50e-94	280	265	0.491	0.513	DCK2_CHICK Deoxycytidine kinase 2 OS=Gallus gallus OX=9031 GN=DCK2 PE=1 SV=1
8	Q6GPW6	2.17e-91	273	265	0.480	0.502	DGUOK_XENLA Deoxyguanosine kinase, mitochondrial OS=Xenopus laevis OX=8355 GN=dguok PE=1 SV=1
9	Q6DD33	1.91e-89	268	264	0.477	0.500	DCK2_XENLA Deoxycytidine kinase 2 OS=Xenopus laevis OX=8355 GN=dck.2 PE=1 SV=1
10	A0A1L8HV70	1.43e-86	261	265	0.451	0.472	DCK1_XENLA Deoxycytidine kinase 1 OS=Xenopus laevis OX=8355 GN=dck.1.L PE=1 SV=1
11	F5CTF3	1.61e-85	258	260	0.451	0.481	F5CTF3_HUMAN Deoxynucleoside kinase OS=Homo sapiens OX=9606 PE=2 SV=1
12	P27707	1.61e-85	258	260	0.451	0.481	DCK_HUMAN Deoxycytidine kinase OS=Homo sapiens OX=9606 GN=DCK PE=1 SV=1
13	P43346	5.45e-85	256	260	0.458	0.488	DCK_MOUSE Deoxycytidine kinase OS=Mus musculus OX=10090 GN=Dck PE=1 SV=1
14	P48769	4.72e-84	254	260	0.451	0.481	DCK_RAT Deoxycytidine kinase OS=Rattus norvegicus OX=10116 GN=Dck PE=1 SV=1
15	D6RFG8	6.86e-83	253	317	0.430	0.375	D6RFG8_HUMAN Deoxycytidine kinase OS=Homo sapiens OX=9606 GN=DCK PE=1 SV=1
16	Q5ZMF3	6.90e-81	246	257	0.426	0.459	DCK_CHICK Deoxycytidine kinase OS=Gallus gallus OX=9031 GN=DCK PE=1 SV=1
17	Q9XZT6	4.57e-37	133	250	0.274	0.304	DNK_DROME Deoxynucleoside kinase OS=Drosophila melanogaster OX=7227 GN=dnk PE=1 SV=1
18	Q501D4	6.42e-37	139	580	0.318	0.152	Q501D4_ARATH At1g72040 OS=Arabidopsis thaliana OX=3702 GN=DNK PE=1 SV=1
19	O00142	2.88e-33	124	265	0.285	0.298	KITM_HUMAN Thymidine kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=TK2 PE=1 SV=4
20	Q9R088	1.46e-32	122	270	0.253	0.259	KITM_MOUSE Thymidine kinase 2, mitochondrial OS=Mus musculus OX=10090 GN=Tk2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	2.1e+02	13.7	AAA ATPase domain
2	PF13238 AAA_18	0.038	26.0	AAA domain
3	PF13671 AAA_33	44	15.7	AAA domain
4	PF01712 dNK	3.1e-73	257.5	Deoxynucleoside kinase
5	PF01926 MMR_HSR1	1.8e+02	13.6	50S ribosome-binding GTPase
6	PF02223 Thymidylate_kin	62	14.7	Thymidylate kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264093

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354532	0.944	Purine nucleoside phosphorylase
2	9606.ENSP00000373674	0.931	5'(3')-deoxyribonucleotidase, mitochondrial
3	9606.ENSP00000346577	0.927	Adenylate kinase isoenzyme 5
4	9606.ENSP00000355689	0.925	Guanylate kinase
5	9606.ENSP00000251810	0.916	Ribonucleoside-diphosphate reductase subunit M2 B
6	9606.ENSP00000359976	0.909	Cystathionine gamma-lyase
7	9606.ENSP00000369456	0.908	Inosine triphosphate pyrophosphatase
8	9606.ENSP00000245552	0.884	5'(3')-deoxyribonucleotidase, cytosolic type
9	9606.ENSP00000369383	0.880	Protein Mpv17
10	9606.ENSP00000377446	0.877	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
11	9606.ENSP00000367923	0.861	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
12	9606.ENSP00000268124	0.859	DNA polymerase subunit gamma-1
13	9606.ENSP00000389948	0.852	7-methylguanosine phosphate-specific 5'-nucleotidase
14	9606.ENSP00000339479	0.848	Cytosolic purine 5'-nucleotidase
15	9606.ENSP00000442563	0.847	DNA polymerase subunit gamma-2, mitochondrial
16	9606.ENSP00000235628	0.845	Cytosolic 5'-nucleotidase 1A
17	9606.ENSP00000484415	0.835	Cytosolic 5'-nucleotidase 3A
18	9606.ENSP00000352904	0.834	Cytosolic 5'-nucleotidase 1B
19	9606.ENSP00000309595	0.822	Twinkle protein, mitochondrial
20	9606.ENSP00000301634	0.821	Thymidine kinase, cytosolic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004138	1.000	deoxyguanosine kinase activity
GO:0004137	0.736	deoxycytidine kinase activity
GO:0004136	0.640	deoxyadenosine kinase activity
GO:0005488	0.577	binding
GO:0005515	0.552	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901293	0.995	nucleoside phosphate biosynthetic process
GO:1901135	0.993	carbohydrate derivative metabolic process
GO:0009117	0.993	nucleotide metabolic process
GO:0072522	0.988	purine-containing compound biosynthetic process
GO:0006164	0.980	purine nucleotide biosynthetic process
GO:1901137	0.977	carbohydrate derivative biosynthetic process
GO:0009123	0.842	nucleoside monophosphate metabolic process
GO:0009124	0.780	nucleoside monophosphate biosynthetic process
GO:0009394	0.771	2'-deoxyribonucleotide metabolic process
GO:0009162	0.743	deoxyribonucleoside monophosphate metabolic process
GO:0009265	0.652	2'-deoxyribonucleotide biosynthetic process
GO:0009116	0.637	nucleoside metabolic process
GO:0009126	0.622	purine nucleoside monophosphate metabolic process
GO:0043094	0.555	cellular metabolic compound salvage
GO:0043101	0.541	purine-containing compound salvage
GO:0009127	0.525	purine nucleoside monophosphate biosynthetic process
GO:0009119	0.514	ribonucleoside metabolic process
GO:0043173	0.483	nucleotide salvage
GO:0042278	0.460	purine nucleoside metabolic process
GO:0046128	0.366	purine ribonucleoside metabolic process
GO:0065007	0.314	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0005634	0.939	nucleus
GO:0005829	0.858	cytosol
GO:0005759	0.774	mitochondrial matrix
GO:0016020	0.422	membrane
GO:0032991	0.355	protein-containing complex
GO:0031981	0.312	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19201	1.000	2'-deoxyguanosine + ATP = ADP + dGMP + H(+)
EC:2.7.1.113	1.000	deoxyguanosine kinase.
RHEA:20061	0.736	2'-deoxycytidine + a ribonucleoside 5'-triphosphate = a ribonucleoside 5'-diphosphate + dCMP + H(+)
EC:2.7.1.74	0.736	deoxycytidine kinase.
RHEA:23452	0.640	2'-deoxyadenosine + ATP = ADP + dAMP + H(+)
EC:2.7.1.76	0.640	deoxyadenosine kinase.

[back to server]