StarFunc result for job id Q16864

User Input

>input (119 residues)
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDD
IGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P50408	0.950	0.950	2.119E-24	119	0.983	0.983	P50408.pdb.gz	VATF_RAT V-type proton ATPase subunit F OS=Rattus norvegicus OX=10116 GN=Atp6v1f PE=1 SV=1
2	AFDB:Q6DRK0	0.969	0.969	1.664E-22	119	0.832	0.832	Q6DRK0.pdb.gz	Q6DRK0_DANRE V-type proton ATPase subunit F OS=Danio rerio OX=7955 GN=zgc:92923 PE=1 SV=1
3	AFDB:Q23680	0.931	0.916	2.218E-20	121	0.697	0.686	Q23680.pdb.gz	VATF_CAEEL Probable V-type proton ATPase subunit F OS=Caenorhabditis elegans OX=6239 GN=vha-9 PE=3 SV=1
4	AFDB:Q24583	0.937	0.900	1.158E-19	124	0.714	0.685	Q24583.pdb.gz	VATF1_DROME V-type proton ATPase subunit F 1 OS=Drosophila melanogaster OX=7227 GN=Vha14-1 PE=1 SV=1
5	PDB:6vq6L	0.878	0.947	9.652E-19	110	0.908	0.982	6vq6L.pdb.gz	Structure of V-ATPase from the mammalian brain.
6	AFDB:Q9ZQX4	0.905	0.843	1.281E-16	128	0.529	0.492	Q9ZQX4.pdb.gz	VATF_ARATH V-type proton ATPase subunit F OS=Arabidopsis thaliana OX=3702 GN=VHA-F PE=2 SV=1
7	AFDB:P39111	0.905	0.912	1.479E-15	118	0.513	0.517	P39111.pdb.gz	VATF_YEAST V-type proton ATPase subunit F OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VMA7 PE=1 SV=1
8	PDB:4rndB	0.813	0.819	1.317E-14	118	0.513	0.517	4rndB.pdb.gz
9	AFDB:O43046	0.898	0.891	1.400E-14	120	0.471	0.467	O43046.pdb.gz	VATF_SCHPO V-type proton ATPase subunit F OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vma7 PE=3 SV=1
10	AFDB:Q55AH5	0.907	0.899	1.400E-14	120	0.454	0.450	Q55AH5.pdb.gz	VATF_DICDI V-type proton ATPase subunit F OS=Dictyostelium discoideum OX=44689 GN=vatF PE=3 SV=1
11	AFDB:A0A1D8PH17	0.879	0.886	5.997E-14	118	0.479	0.483	A0A1D8PH17.pdb.gz	A0A1D8PH17_CANAL V-type proton ATPase subunit F OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VMA7 PE=3 SV=1
12	AFDB:Q4GYJ5	0.882	0.793	3.168E-12	133	0.395	0.353	Q4GYJ5.pdb.gz	Q4GYJ5_TRYB2 V-type proton ATPase subunit F OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3820 PE=3 SV=1
13	PDB:1yzgA	0.449	0.357	1.614E-2	168	0.151	0.107	1yzgA.pdb.gz	Structure of Human ADP-ribosylation factor-like 8
14	PDB:1eudB	0.490	0.188	5.307E-2	395	0.160	0.048	1eudB.pdb.gz
15	PDB:7cgpB	0.430	0.185	6.913E-2	345	0.126	0.043	7cgpB.pdb.gz
16	PDB:1puiA	0.393	0.300	1.098E-1	169	0.160	0.112	1puiA.pdb.gz
17	PDB:1zj6A	0.424	0.328	1.173E-1	173	0.109	0.075	1zj6A.pdb.gz	2.0A crystal structure of human ARL5-GDP3'P, a novel member of the small GTP-binding proteins
18	PDB:5ie2A	0.319	0.102	1.173E-1	506	0.076	0.018	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
19	PDB:7d5sRI	0.322	0.192	1.253E-1	252	0.101	0.048	7d5sRI.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
20	PDB:3p9yA	0.310	0.213	1.528E-1	198	0.193	0.116	3p9yA.pdb.gz	cis-Proline-mediated Ser(P)5 Dephosphorylation by the RNA Polymerase II C-terminal Domain Phosphatase Ssu72.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16864	2.44e-84	243	119	1.000	1.000	VATF_HUMAN V-type proton ATPase subunit F OS=Homo sapiens OX=9606 GN=ATP6V1F PE=1 SV=2
2	Q28029	1.63e-83	241	119	0.992	0.992	VATF_BOVIN V-type proton ATPase subunit F OS=Bos taurus OX=9913 GN=ATP6V1F PE=1 SV=2
3	P50408	3.88e-83	240	119	0.983	0.983	VATF_RAT V-type proton ATPase subunit F OS=Rattus norvegicus OX=10116 GN=Atp6v1f PE=1 SV=1
4	Q9D1K2	3.88e-83	240	119	0.983	0.983	VATF_MOUSE V-type proton ATPase subunit F OS=Mus musculus OX=10090 GN=Atp6v1f PE=1 SV=2
5	Q6DRK0	2.13e-72	213	119	0.832	0.832	Q6DRK0_DANRE V-type proton ATPase subunit F OS=Danio rerio OX=7955 GN=zgc:92923 PE=1 SV=1
6	Q24583	3.27e-62	187	124	0.706	0.677	VATF1_DROME V-type proton ATPase subunit F 1 OS=Drosophila melanogaster OX=7227 GN=Vha14-1 PE=1 SV=1
7	Q23680	6.61e-59	179	121	0.697	0.686	VATF_CAEEL Probable V-type proton ATPase subunit F OS=Caenorhabditis elegans OX=6239 GN=vha-9 PE=3 SV=1
8	Q9ZQX4	1.13e-43	140	128	0.529	0.492	VATF_ARATH V-type proton ATPase subunit F OS=Arabidopsis thaliana OX=3702 GN=VHA-F PE=2 SV=1
9	Q55AH5	1.00e-37	125	120	0.454	0.450	VATF_DICDI V-type proton ATPase subunit F OS=Dictyostelium discoideum OX=44689 GN=vatF PE=3 SV=1
10	A0A1D8PH17	8.30e-35	118	118	0.479	0.483	A0A1D8PH17_CANAL V-type proton ATPase subunit F OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VMA7 PE=3 SV=1
11	P39111	1.33e-34	117	118	0.521	0.525	VATF_YEAST V-type proton ATPase subunit F OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VMA7 PE=1 SV=1
12	O43046	1.74e-33	114	120	0.462	0.458	VATF_SCHPO V-type proton ATPase subunit F OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vma7 PE=3 SV=1
13	Q9VNL3	4.38e-26	96.3	129	0.353	0.326	VATF2_DROME V-type proton ATPase subunit F 2 OS=Drosophila melanogaster OX=7227 GN=Vha14-2 PE=3 SV=2
14	Q4GYJ5	7.33e-25	93.2	133	0.412	0.368	Q4GYJ5_TRYB2 V-type proton ATPase subunit F OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3820 PE=3 SV=1
15	H1AE12	3.6	29.3	742	0.118	0.019	EGCR1_CRYNH Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1
16	Q584R8	5.6	28.9	721	0.126	0.021	Q584R8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.830 PE=4 SV=1
17	Q9LQV2	7.2	28.5	1107	0.084	0.009	RDR1_ARATH RNA-dependent RNA polymerase 1 OS=Arabidopsis thaliana OX=3702 GN=RDR1 PE=2 SV=1
18	Q9UTT1	7.3	28.5	1129	0.176	0.019	UBP71_SCHPO Ubiquitin carboxyl-terminal hydrolase 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp15 PE=1 SV=2
19	Q8W2B8	8.6	28.1	355	0.118	0.039	SAT4_ARATH Serine acetyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=SAT4 PE=1 SV=1
20	Q9SY60	8.9	28.1	769	0.185	0.029	EX84C_ARATH Exocyst complex component EXO84C OS=Arabidopsis thaliana OX=3702 GN=EXO84C PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01990 ATP-synt_F	6.4e-29	111.5	ATP synthase (F/14-kDa) subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000060050

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000010960	0.995	ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D
2	9598.ENSPTRP00000036372	0.994	V-type proton ATPase subunit G
3	9598.ENSPTRP00000026278	0.993	ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A
4	9598.ENSPTRP00000034674	0.993	Uncharacterized protein
5	9598.ENSPTRP00000013077	0.989	V-type proton ATPase proteolipid subunit
6	9598.ENSPTRP00000034316	0.985	ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2
7	9598.ENSPTRP00000058391	0.984	V-type proton ATPase subunit C
8	9598.ENSPTRP00000053075	0.967	V-type proton ATPase subunit a
9	9598.ENSPTRP00000038673	0.961	Uncharacterized protein
10	9598.ENSPTRP00000047847	0.961	V-type proton ATPase subunit
11	9598.ENSPTRP00000030648	0.957	Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells
12	9598.ENSPTRP00000001128	0.953	Uncharacterized protein
13	9598.ENSPTRP00000020416	0.950	Uncharacterized protein
14	9598.ENSPTRP00000037408	0.943	ATPase, H+ transporting, lysosomal accessory protein 2
15	9598.ENSPTRP00000014055	0.921	V-type proton ATPase subunit
16	9598.ENSPTRP00000003029	0.917	V-type proton ATPase subunit G
17	9598.ENSPTRP00000057103	0.892	V-type proton ATPase subunit C
18	9598.ENSPTRP00000020664	0.887	Uncharacterized protein
19	9598.ENSPTRP00000034883	0.881	V-type proton ATPase subunit
20	9598.ENSPTRP00000033994	0.847	ATPase, H+ transporting V0 subunit e2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0022857	0.987	transmembrane transporter activity
GO:0015399	0.968	primary active transmembrane transporter activity
GO:0015078	0.968	proton transmembrane transporter activity
GO:0042625	0.939	ATPase-coupled ion transmembrane transporter activity
GO:0019829	0.938	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0009678	0.938	pyrophosphate hydrolysis-driven proton transmembrane transporter activity
GO:0046961	0.932	proton-transporting ATPase activity, rotational mechanism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902600	0.998	proton transmembrane transport
GO:0042592	0.994	homeostatic process
GO:0065007	0.981	biological regulation
GO:0006885	0.879	regulation of pH
GO:0045851	0.359	pH reduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031090	0.998	organelle membrane
GO:0016469	0.997	proton-transporting two-sector ATPase complex
GO:0033176	0.981	proton-transporting V-type ATPase complex
GO:0098588	0.962	bounding membrane of organelle
GO:0016471	0.948	vacuolar proton-transporting V-type ATPase complex
GO:1902495	0.922	transmembrane transporter complex
GO:0012505	0.723	endomembrane system
GO:0031982	0.697	vesicle
GO:0071944	0.674	cell periphery
GO:0005886	0.614	plasma membrane
GO:0005829	0.372	cytosol
GO:0000221	0.371	vacuolar proton-transporting V-type ATPase, V1 domain
GO:0005739	0.327	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.968	Translocases.
RHEA:13973	0.938	diphosphate + H(+)(in) + H2O = 2 H(+)(out) + 2 phosphate
EC:7.1.3.1	0.938	H(+)-exporting diphosphatase.
RHEA:57721	0.932	ATP + 4 H(+)(in) + H2O => ADP + 5 H(+)(out) + phosphate

[back to server]