StarFunc result for job id Q16873

User Input

>input (150 residues)
MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYF
PLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVA
LAALGLLAHFLPAALRAALLGRLRTLLPWA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16873	1.000	1.000	2.110E-20	150	1.000	1.000	Q16873.pdb.gz	LTC4S_HUMAN Leukotriene C4 synthase OS=Homo sapiens OX=9606 GN=LTC4S PE=1 SV=1
2	PDB:4jrzA	0.964	0.933	6.727E-19	155	0.980	0.948	4jrzA.pdb.gz	Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
3	AFDB:Q60860	0.991	0.991	1.795E-18	150	0.880	0.880	Q60860.pdb.gz	LTC4S_MOUSE Leukotriene C4 synthase OS=Mus musculus OX=10090 GN=Ltc4s PE=1 SV=1
4	PDB:4ntaA	0.927	0.946	4.196E-17	147	0.840	0.857	4ntaA.pdb.gz
5	AFDB:Q99735	0.888	0.906	9.386E-11	147	0.433	0.442	Q99735.pdb.gz	MGST2_HUMAN Microsomal glutathione S-transferase 2 OS=Homo sapiens OX=9606 GN=MGST2 PE=1 SV=1
6	PDB:6sswB	0.854	0.915	2.311E-9	140	0.407	0.436	6sswB.pdb.gz	Crystal structures of human MGST2 reveal synchronized conformational changes regulating catalysis.
7	AFDB:A0A0G2JU12	0.758	0.886	3.571E-8	128	0.327	0.383	A0A0G2JU12.pdb.gz	A0A0G2JU12_RAT Microsomal glutathione S-transferase 2 OS=Rattus norvegicus OX=10116 GN=Mgst2 PE=1 SV=2
8	AFDB:P20291	0.832	0.777	3.960E-8	161	0.327	0.304	P20291.pdb.gz	AL5AP_RAT Arachidonate 5-lipoxygenase-activating protein OS=Rattus norvegicus OX=10116 GN=Alox5ap PE=1 SV=2
9	AFDB:F1QKS8	0.778	0.750	3.846E-7	156	0.280	0.269	F1QKS8.pdb.gz	F1QKS8_DANRE Arachidonate 5-lipoxygenase-activating protein OS=Danio rerio OX=7955 GN=wu:fj65d02 PE=4 SV=1
10	PDB:6vgcD	0.745	0.722	6.944E-6	155	0.313	0.303	6vgcD.pdb.gz	Structure-based, multi-targeted drug discovery approach to eicosanoid inhibition: Dual inhibitors of mPGES-1 and 5-lipoxygenase activating protein (FLAP).
11	AFDB:O14880	0.805	0.795	1.587E-5	152	0.213	0.211	O14880.pdb.gz	MGST3_HUMAN Glutathione S-transferase 3, mitochondrial OS=Homo sapiens OX=9606 GN=MGST3 PE=1 SV=1
12	AFDB:D4ADS4	0.804	0.794	1.853E-5	152	0.200	0.197	D4ADS4.pdb.gz	D4ADS4_RAT Microsomal glutathione S-transferase 3 OS=Rattus norvegicus OX=10116 GN=Mgst3 PE=4 SV=1
13	PDB:4bpmA	0.703	0.657	3.345E-4	162	0.293	0.272	4bpmA.pdb.gz	Crystallizing Membrane Proteins in the Lipidic Mesophase. Experience with Human Prostaglandin E2 Synthase 1 and an Evolving Strategy.
14	AFDB:F4IBL0	0.674	0.528	7.643E-4	194	0.213	0.165	F4IBL0.pdb.gz	F4IBL0_ARATH Microsomal glutathione s-transferase OS=Arabidopsis thaliana OX=3702 GN=At1g65820 PE=1 SV=1
15	AFDB:P64515	0.706	0.799	8.475E-4	131	0.213	0.244	P64515.pdb.gz	YECN_ECOLI Inner membrane protein YecN OS=Escherichia coli (strain K12) OX=83333 GN=yecN PE=1 SV=1
16	PDB:7uw9i	0.390	0.378	1.648E-1	156	0.120	0.115	7uw9i.pdb.gz
17	PDB:3aouA	0.384	0.373	3.397E-1	156	0.193	0.186	3aouA.pdb.gz	Structure of the rotor ring modified with N,N'-dicyclohexylcarbodiimide of the Na+-transporting vacuolar ATPase.
18	PDB:6wlw0	0.321	0.262	3.397E-1	204	0.120	0.088	6wlw0.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
19	PDB:5tj5B	0.272	0.251	5.136E-1	187	0.147	0.118	5tj5B.pdb.gz
20	PDB:7taoD	0.372	0.357	5.695E-1	158	0.140	0.133	7taoD.pdb.gz	Cryo-EM of the Yeast V O Complex Reveals Distinct Binding Sites for Macrolide V-ATPase Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16873	9.81e-101	287	150	1.000	1.000	LTC4S_HUMAN Leukotriene C4 synthase OS=Homo sapiens OX=9606 GN=LTC4S PE=1 SV=1
2	Q60860	2.32e-88	256	150	0.880	0.880	LTC4S_MOUSE Leukotriene C4 synthase OS=Mus musculus OX=10090 GN=Ltc4s PE=1 SV=1
3	Q925U2	2.71e-86	250	150	0.867	0.867	LTC4S_RAT Leukotriene C4 synthase OS=Rattus norvegicus OX=10116 GN=Ltc4s PE=1 SV=3
4	Q99735	1.20e-31	112	147	0.347	0.354	MGST2_HUMAN Microsomal glutathione S-transferase 2 OS=Homo sapiens OX=9606 GN=MGST2 PE=1 SV=1
5	A0A8I5ZLK2	3.12e-27	100	147	0.313	0.320	A0A8I5ZLK2_RAT Microsomal glutathione S-transferase 2 OS=Rattus norvegicus OX=10116 GN=Mgst2 PE=4 SV=1
6	A0A8I5ZSH5	5.36e-20	80.5	82	0.233	0.427	A0A8I5ZSH5_RAT Microsomal glutathione S-transferase 2 OS=Rattus norvegicus OX=10116 GN=Mgst2 PE=1 SV=1
7	P30355	7.22e-19	79.7	161	0.340	0.317	AL5AP_MOUSE Arachidonate 5-lipoxygenase-activating protein OS=Mus musculus OX=10090 GN=Alox5ap PE=1 SV=2
8	P20291	1.27e-18	79.3	161	0.347	0.323	AL5AP_RAT Arachidonate 5-lipoxygenase-activating protein OS=Rattus norvegicus OX=10116 GN=Alox5ap PE=1 SV=2
9	A0A0G2JU12	8.91e-18	75.9	119	0.227	0.286	A0A0G2JU12_RAT Microsomal glutathione S-transferase 2 OS=Rattus norvegicus OX=10116 GN=Mgst2 PE=1 SV=2
10	P20292	6.55e-17	74.7	161	0.320	0.298	AL5AP_HUMAN Arachidonate 5-lipoxygenase-activating protein OS=Homo sapiens OX=9606 GN=ALOX5AP PE=1 SV=2
11	F1QKS8	5.28e-11	59.3	156	0.213	0.205	F1QKS8_DANRE Arachidonate 5-lipoxygenase-activating protein OS=Danio rerio OX=7955 GN=wu:fj65d02 PE=4 SV=1
12	A0A8I6ADF7	1.49e-09	53.5	77	0.167	0.325	A0A8I6ADF7_RAT Microsomal glutathione S-transferase 2 OS=Rattus norvegicus OX=10116 GN=Mgst2 PE=4 SV=1
13	G5EGH9	0.59	32.3	585	0.113	0.029	G5EGH9_CAEEL NADPH-dependent diflavin oxidoreductase 1 OS=Caenorhabditis elegans OX=6239 GN=fre-1 PE=1 SV=1
14	Q57XP4	0.59	32.3	1203	0.133	0.017	Q57XP4_TRYB2 Nucleoporin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.260 PE=4 SV=1
15	A2BGT8	0.85	32.0	4611	0.120	0.004	A2BGT8_DANRE FAT atypical cadherin 1a OS=Danio rerio OX=7955 GN=fat PE=1 SV=1
16	F4IBL0	0.86	31.6	194	0.173	0.134	F4IBL0_ARATH Microsomal glutathione s-transferase OS=Arabidopsis thaliana OX=3702 GN=At1g65820 PE=1 SV=1
17	O60476	3.6	30.0	641	0.147	0.034	MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
18	Q7M732	3.7	30.0	1744	0.093	0.008	RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus OX=10090 GN=Rtl1 PE=2 SV=1
19	Q727H0	4.1	29.6	397	0.100	0.038	Q727H0_DESVH Alcohol dehydrogenase, iron-containing OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2885 PE=1 SV=1
20	P39098	4.6	29.6	641	0.147	0.034	MA1A2_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01124 MAPEG	1.5e-12	59.0	MAPEG family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000292596

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363512	0.986	Arachidonate 5-lipoxygenase
2	9606.ENSP00000228740	0.969	Leukotriene A-4 hydrolase
3	9606.ENSP00000381340	0.925	Glutathione hydrolase 5 proenzyme
4	9606.ENSP00000383232	0.908	Glutathione hydrolase 1 proenzyme
5	9606.ENSP00000379512	0.901	Microsomal glutathione S-transferase 1
6	9606.ENSP00000478492	0.840	Cysteinyl leukotriene receptor 1
7	9606.ENSP00000282018	0.822	Cysteinyl leukotriene receptor 2
8	9606.ENSP00000356864	0.770	Microsomal glutathione S-transferase 3
9	9606.ENSP00000479870	0.755	Arachidonate 5-lipoxygenase-activating protein
10	9606.ENSP00000342385	0.645	Prostaglandin E synthase
11	9606.ENSP00000356436	0.629	Cytosolic phospholipase A2
12	9606.ENSP00000298440	0.586	2-oxoglutarate receptor 1
13	9606.ENSP00000380008	0.586	Leukotriene B4 receptor 1
14	9606.ENSP00000445772	0.546	Leukotriene B4 receptor 2
15	9606.ENSP00000393333	0.517	Thromboxane A2 receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008289	0.999	lipid binding
GO:0005515	0.999	protein binding
GO:0004464	0.999	leukotriene-C4 synthase activity
GO:0042802	0.976	identical protein binding
GO:0016491	0.679	oxidoreductase activity
GO:0016740	0.632	transferase activity
GO:0043167	0.517	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0046394	0.986	carboxylic acid biosynthetic process
GO:0006690	0.985	icosanoid metabolic process
GO:0044238	0.963	primary metabolic process
GO:0006631	0.888	fatty acid metabolic process
GO:0072330	0.843	monocarboxylic acid biosynthetic process
GO:0006633	0.819	fatty acid biosynthetic process
GO:0001676	0.665	long-chain fatty acid metabolic process
GO:0042759	0.463	long-chain fatty acid biosynthetic process
GO:0006691	0.433	leukotriene metabolic process
GO:0050896	0.421	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.997	cytoplasm
GO:0012505	0.996	endomembrane system
GO:0031090	0.987	organelle membrane
GO:0005634	0.968	nucleus
GO:0031984	0.860	organelle subcompartment
GO:0042175	0.854	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005783	0.836	endoplasmic reticulum
GO:0098588	0.834	bounding membrane of organelle
GO:0031975	0.796	envelope
GO:0031967	0.790	organelle envelope
GO:0098827	0.772	endoplasmic reticulum subcompartment
GO:0005789	0.759	endoplasmic reticulum membrane
GO:0019867	0.755	outer membrane
GO:0005635	0.750	nuclear envelope
GO:0031968	0.746	organelle outer membrane
GO:0031965	0.637	nuclear membrane
GO:0005640	0.554	nuclear outer membrane
GO:0070013	0.369	intracellular organelle lumen
GO:0071944	0.352	cell periphery
GO:0005886	0.325	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17617	0.999	leukotriene C4 = glutathione + leukotriene A4
EC:4.4.1.20	0.999	leukotriene-C4 synthase.
EC:1.-.-.-	0.679	Oxidoreductases.
EC:2.-.-.-	0.632	Transferases.

[back to server]