StarFunc result for job id Q16877

User Input

>input (469 residues)
MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPARGKTYISKKLT
RYLNWIGVPTREFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSE
EGGHVAVFDATNTTRERRATIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYV
NRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVY
YLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFAKSLAQFISDQNIKDLKVW
TSQMKRTIQTAEALGVPYEQWKVLNEIDAGVCEEMTYEEIQDNYPLEFALRDQDKYRYRY
PKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEQLPYLKCPLHTV
LKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPPEEALVTVPAHQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P25114	0.982	0.982	9.598E-93	469	0.972	0.972	P25114.pdb.gz	F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus OX=10116 GN=Pfkfb4 PE=1 SV=3
2	AFDB:P07953	0.974	0.970	1.304E-81	471	0.740	0.737	P07953.pdb.gz	F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus OX=10116 GN=Pfkfb1 PE=1 SV=3
3	PDB:1bifA	0.913	0.991	1.571E-80	432	0.889	0.965	1bifA.pdb.gz	The crystal structure of the bifunctional enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase reveals distinct domain homologies.
4	AFDB:Q91348	0.973	0.971	2.702E-79	470	0.738	0.736	Q91348.pdb.gz	F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus OX=9031 PE=2 SV=2
5	AFDB:A0A1W2PR17	0.933	0.773	2.633E-76	568	0.684	0.565	A0A1W2PR17.pdb.gz	A0A1W2PR17_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
6	AFDB:O35552	0.934	0.790	2.198E-75	555	0.680	0.575	O35552.pdb.gz	F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus OX=10116 GN=Pfkfb3 PE=2 SV=1
7	PDB:1k6mA	0.915	0.993	1.861E-73	432	0.716	0.778	1k6mA.pdb.gz	Tissue-specific structure/function differentiation of the liver isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.
8	AFDB:Q9JJH5	0.895	0.755	2.249E-71	557	0.648	0.546	Q9JJH5.pdb.gz	F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus OX=10116 GN=Pfkfb2 PE=1 SV=1
9	PDB:2axnA	0.909	0.945	3.246E-71	451	0.678	0.705	2axnA.pdb.gz	Crystal structure of the hypoxia-inducible form of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB3): a possible new target for cancer therapy.
10	PDB:5htkA	0.851	0.936	1.381E-65	425	0.655	0.722	5htkA.pdb.gz	Crystal structure of heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) and the inhibitory influence of citrate on substrate binding.
11	AFDB:Q9N590	0.862	0.898	7.652E-60	450	0.510	0.531	Q9N590.pdb.gz	Q9N590_CAEEL 6-phosphofructo-2-kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pfkb-1.1 PE=1 SV=2
12	AFDB:P32604	0.864	0.896	7.330E-55	452	0.424	0.440	P32604.pdb.gz	F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FBP26 PE=1 SV=2
13	AFDB:Q9MB58	0.815	0.521	9.652E-47	744	0.397	0.250	Q9MB58.pdb.gz	F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana OX=3702 GN=FKFBP PE=1 SV=1
14	AFDB:P40433	0.811	0.463	1.137E-45	827	0.367	0.208	P40433.pdb.gz	6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFK26 PE=1 SV=1
15	PDB:1e58A	0.347	0.630	1.156E-11	247	0.113	0.215	1e58A.pdb.gz
16	PDB:6s2rA	0.360	0.684	1.631E-11	234	0.098	0.197	6s2rA.pdb.gz
17	PDB:4embA	0.358	0.659	5.134E-11	245	0.100	0.192	4embA.pdb.gz
18	PDB:1riiA	0.353	0.652	6.098E-11	243	0.109	0.210	1riiA.pdb.gz
19	PDB:2h4zA	0.343	0.604	6.458E-11	255	0.119	0.220	2h4zA.pdb.gz	Seeing the process of histidine phosphorylation in human bisphosphoglycerate mutase.
20	PDB:1yjxA	0.356	0.653	7.243E-11	245	0.100	0.192	1yjxA.pdb.gz	Crystal structure of human B-type phosphoglycerate mutase bound with citrate.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1W2PR17	0.0	687	568	0.684	0.565	A0A1W2PR17_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
2	F2Z2I2	0.0	686	455	0.684	0.705	F2Z2I2_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
3	O35552	0.0	689	555	0.682	0.577	F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus OX=10116 GN=Pfkfb3 PE=2 SV=1
4	O60825	0.0	667	505	0.661	0.614	F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=2
5	P07953	0.0	737	471	0.742	0.739	F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus OX=10116 GN=Pfkfb1 PE=1 SV=3
6	P16118	0.0	743	471	0.753	0.749	F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens OX=9606 GN=PFKFB1 PE=1 SV=3
7	P25114	0.0	955	469	0.972	0.972	F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus OX=10116 GN=Pfkfb4 PE=1 SV=3
8	P70265	0.0	660	519	0.661	0.597	F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus OX=10090 GN=Pfkfb2 PE=1 SV=2
9	Q16875	0.0	687	520	0.684	0.617	F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
10	Q16877	0.0	979	469	1.000	1.000	F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens OX=9606 GN=PFKFB4 PE=1 SV=6
11	Q28901	0.0	667	463	0.676	0.685	F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus OX=9913 GN=PFKFB3 PE=1 SV=2
12	Q5VX20	0.0	685	526	0.684	0.610	Q5VX20_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
13	Q5W015	0.0	686	513	0.684	0.626	Q5W015_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
14	Q91348	0.0	727	470	0.738	0.736	F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus OX=9031 PE=2 SV=2
15	Q9JJH5	0.0	664	557	0.661	0.557	F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus OX=10116 GN=Pfkfb2 PE=1 SV=1
16	Q9N590	6.00e-166	477	450	0.497	0.518	Q9N590_CAEEL 6-phosphofructo-2-kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pfkb-1.1 PE=1 SV=2
17	P32604	4.31e-138	406	452	0.424	0.440	F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FBP26 PE=1 SV=2
18	Q9MB58	1.72e-110	345	744	0.386	0.243	F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana OX=3702 GN=FKFBP PE=1 SV=1
19	P40433	4.60e-92	298	827	0.369	0.209	6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFK26 PE=1 SV=1
20	Q9UTE1	8.50e-77	253	592	0.313	0.248	YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC222.13c PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01591 6PF2K	8.3e-99	340.9	6-phosphofructo-2-kinase
2	PF13238 AAA_18	1.4e+02	14.4	AAA domain
3	PF13671 AAA_33	0.0019	29.8	AAA domain
4	PF00300 His_Phos_1	8.1e-38	141.6	Histidine phosphatase superfamily (branch 1)
5	PF00328 His_Phos_2	1.1e+02	13.6	Histidine phosphatase superfamily (branch 2)
6	PF08433 KTI12	11	17.0	Chromatin associated protein KTI12
7	PF02996 Prefoldin	3.9	18.8	Prefoldin subunit
8	PF06414 Zeta_toxin	2.1e+02	12.6	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000232375

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000179259	0.992	Fructose-2,6-bisphosphatase TIGAR
2	9606.ENSP00000443319	0.973	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3
3	9606.ENSP00000364145	0.922	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1
4	9606.ENSP00000318318	0.908	Mannose-6-phosphate isomerase
5	9606.ENSP00000345771	0.908	ATP-dependent 6-phosphofructokinase, muscle type
6	9606.ENSP00000356047	0.903	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
7	9606.ENSP00000370517	0.870	ATP-dependent 6-phosphofructokinase, platelet type
8	9606.ENSP00000269848	0.862	ATP-dependent 6-phosphofructokinase, liver type
9	9606.ENSP00000290573	0.830	Hexokinase-2
10	9606.ENSP00000408025	0.829	Fructose-1,6-bisphosphatase 1
11	9606.ENSP00000364486	0.738	Fructose-1,6-bisphosphatase isozyme 2
12	9606.ENSP00000346643	0.710	Putative hexokinase HKDC1
13	9606.ENSP00000402103	0.706	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
14	9606.ENSP00000292432	0.704	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
15	9606.ENSP00000229328	0.671	5'-AMP-activated protein kinase subunit beta-1
16	9606.ENSP00000323867	0.665	5'-AMP-activated protein kinase subunit gamma-1
17	9606.ENSP00000360290	0.655	5'-AMP-activated protein kinase catalytic subunit alpha-2
18	9606.ENSP00000346148	0.654	5'-AMP-activated protein kinase catalytic subunit alpha-1
19	9606.ENSP00000254101	0.652	5'-AMP-activated protein kinase subunit beta-2
20	9606.ENSP00000397133	0.640	5'-AMP-activated protein kinase subunit gamma-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0050308	0.998	sugar-phosphatase activity
GO:0008443	0.998	phosphofructokinase activity
GO:0003873	0.990	6-phosphofructo-2-kinase activity
GO:0004331	0.988	fructose-2,6-bisphosphate 2-phosphatase activity
GO:0019899	0.487	enzyme binding
GO:0042802	0.389	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.994	primary metabolic process
GO:0006793	0.991	phosphorus metabolic process
GO:0006796	0.980	phosphate-containing compound metabolic process
GO:1901135	0.972	carbohydrate derivative metabolic process
GO:0019637	0.969	organophosphate metabolic process
GO:0005975	0.923	carbohydrate metabolic process
GO:0016310	0.889	phosphorylation
GO:0006807	0.802	nitrogen compound metabolic process
GO:0044281	0.770	small molecule metabolic process
GO:0050789	0.668	regulation of biological process
GO:0032787	0.631	monocarboxylic acid metabolic process
GO:0005996	0.609	monosaccharide metabolic process
GO:1901564	0.578	organonitrogen compound metabolic process
GO:0019222	0.538	regulation of metabolic process
GO:0006090	0.532	pyruvate metabolic process
GO:0019318	0.498	hexose metabolic process
GO:0016052	0.497	carbohydrate catabolic process
GO:0080090	0.463	regulation of primary metabolic process
GO:1901360	0.443	organic cyclic compound metabolic process
GO:0046483	0.439	heterocycle metabolic process
GO:0034641	0.417	cellular nitrogen compound metabolic process
GO:0006139	0.414	nucleobase-containing compound metabolic process
GO:0019693	0.413	ribose phosphate metabolic process
GO:0050794	0.411	regulation of cellular process
GO:0006163	0.398	purine nucleotide metabolic process
GO:0006091	0.376	generation of precursor metabolites and energy
GO:0009150	0.348	purine ribonucleotide metabolic process
GO:0006109	0.338	regulation of carbohydrate metabolic process
GO:0009132	0.335	nucleoside diphosphate metabolic process
GO:0006165	0.333	nucleoside diphosphate phosphorylation
GO:0046034	0.333	ATP metabolic process
GO:0046031	0.325	ADP metabolic process
GO:0006757	0.318	ATP generation from ADP
GO:0006096	0.308	glycolytic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0043227	0.842	membrane-bounded organelle
GO:0043231	0.701	intracellular membrane-bounded organelle
GO:0070013	0.571	intracellular organelle lumen
GO:0005654	0.537	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.998	Phosphotransferases with an alcohol group as acceptor.
EC:3.1.3.23	0.998	sugar-phosphatase.
RHEA:15653	0.990	ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+)
EC:2.7.1.105	0.990	6-phosphofructo-2-kinase.
RHEA:17289	0.988	beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate
EC:3.1.3.46	0.988	fructose-2,6-bisphosphate 2-phosphatase.

[back to server]