StarFunc result for job id Q16890

User Input

>input (204 residues)
MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAK
ERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTA
ISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLS
STAHASAQSLAGGSRRTKEEELQC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16890	1.000	1.000	3.395E-29	204	1.000	1.000	Q16890.pdb.gz	TPD53_HUMAN Tumor protein D53 OS=Homo sapiens OX=9606 GN=TPD52L1 PE=1 SV=1
2	AFDB:Q9I8F4	0.323	0.316	2.129E-21	210	0.833	0.810	Q9I8F4.pdb.gz	TPD53_CHICK Tumor protein D53 homolog OS=Gallus gallus OX=9031 GN=TPD52L1 PE=2 SV=1
3	AFDB:Q62393	0.246	0.227	9.605E-11	224	0.490	0.446	Q62393.pdb.gz	TPD52_MOUSE Tumor protein D52 OS=Mus musculus OX=10090 GN=Tpd52 PE=1 SV=2
4	AFDB:O43399	0.245	0.243	2.611E-6	206	0.402	0.398	O43399.pdb.gz	TPD54_HUMAN Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 PE=1 SV=2
5	AFDB:Q96J77	0.333	0.466	1.828E-4	140	0.299	0.436	Q96J77.pdb.gz	TPD55_HUMAN Tumor protein D55 OS=Homo sapiens OX=9606 GN=TPD52L3 PE=1 SV=2
6	AFDB:Q93ZH7	0.185	0.099	1.071E-1	461	0.147	0.065	Q93ZH7.pdb.gz	IQD2_ARATH Protein IQ-DOMAIN 2 OS=Arabidopsis thaliana OX=3702 GN=IQD2 PE=1 SV=1
7	AFDB:Q8GZ87	0.191	0.074	2.125E-1	664	0.147	0.045	Q8GZ87.pdb.gz	IQD28_ARATH Protein IQ-DOMAIN 28 OS=Arabidopsis thaliana OX=3702 GN=IQD28 PE=1 SV=1
8	AFDB:A0A060XT52	0.183	0.155	4.836E-1	243	0.147	0.123	A0A060XT52.pdb.gz	A0A060XT52_ONCMY Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00050634001 PE=3 SV=1
9	AFDB:Q9FXI5	0.154	0.049	8.367E-1	794	0.113	0.029	Q9FXI5.pdb.gz	IQD32_ARATH Protein IQ-DOMAIN 32 OS=Arabidopsis thaliana OX=3702 GN=IQD32 PE=1 SV=3
10	AFDB:M0QXU7	0.176	0.143	1.028	273	0.167	0.125	M0QXU7.pdb.gz	M0QXU7_HUMAN Translocase of inner mitochondrial membrane 44 (Fragment) OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=1
11	PDB:2m0qA	0.173	0.243	2.412	123	0.088	0.146	2m0qA.pdb.gz
12	PDB:7pd3q	0.157	0.160	2.583	198	0.142	0.146	7pd3q.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
13	PDB:5ijnH	0.167	0.201	2.767	169	0.103	0.124	5ijnH.pdb.gz
14	PDB:7r0wI	0.104	0.097	2.963	222	0.044	0.041	7r0wI.pdb.gz	Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
15	PDB:7r5jH0	0.179	0.098	5.126	383	0.098	0.052	7r5jH0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	PDB:8at3A	0.174	0.126	5.126	286	0.123	0.087	8at3A.pdb.gz
17	PDB:7nacw	0.135	0.049	7.221	672	0.142	0.043	7nacw.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
18	PDB:5hsjA	0.152	0.055	8.281	606	0.044	0.015	5hsjA.pdb.gz	Crystal structure of tyrosine decarboxylase and identification of key residues involved in conformational swing and substrate binding
19	PDB:7mqaNS	0.095	0.028	8.281	914	0.034	0.008	7mqaNS.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:5x3tA	0.122	0.226	9.498	70	0.044	0.129	5x3tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16890	7.71e-151	418	204	1.000	1.000	TPD53_HUMAN Tumor protein D53 OS=Homo sapiens OX=9606 GN=TPD52L1 PE=1 SV=1
2	Q9I8F4	1.36e-108	311	210	0.838	0.814	TPD53_CHICK Tumor protein D53 homolog OS=Gallus gallus OX=9031 GN=TPD52L1 PE=2 SV=1
3	P55327	8.23e-53	171	224	0.515	0.469	TPD52_HUMAN Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52 PE=1 SV=2
4	Q62393	3.02e-50	164	224	0.485	0.442	TPD52_MOUSE Tumor protein D52 OS=Mus musculus OX=10090 GN=Tpd52 PE=1 SV=2
5	O43399	2.03e-37	130	206	0.377	0.374	TPD54_HUMAN Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 PE=1 SV=2
6	Q6FGS1	2.03e-37	130	206	0.377	0.374	Q6FGS1_HUMAN TPD52L2 protein OS=Homo sapiens OX=9606 GN=TPD52L2 PE=1 SV=1
7	Q96J77	9.16e-24	93.6	140	0.279	0.407	TPD55_HUMAN Tumor protein D55 OS=Homo sapiens OX=9606 GN=TPD52L3 PE=1 SV=2
8	A1ZAC2	0.32	33.5	192	0.083	0.089	A1ZAC2_DROME BZIP domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7786 PE=1 SV=1
9	P02469	1.4	32.3	1786	0.137	0.016	LAMB1_MOUSE Laminin subunit beta-1 OS=Mus musculus OX=10090 GN=Lamb1 PE=1 SV=3
10	P42762	2.4	31.6	945	0.157	0.034	CLPD_ARATH Chaperone protein ClpD, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPD PE=1 SV=1
11	A0A8I5ZVQ5	2.9	31.2	1741	0.093	0.011	A0A8I5ZVQ5_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
12	Q9P797	3.0	31.2	1142	0.088	0.016	NU131_SCHPO Nucleoporin nup131 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup131 PE=1 SV=3
13	D3ZQN7	3.2	31.2	1786	0.093	0.011	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
14	A0A8I5ZQ25	3.3	31.2	1834	0.093	0.010	A0A8I5ZQ25_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
15	A0A8I6A3T2	3.3	31.2	1792	0.093	0.011	A0A8I6A3T2_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
16	P85001	5.4	30.4	2439	0.137	0.011	CE290_DANRE Centrosomal protein of 290 kDa OS=Danio rerio OX=7955 GN=cep290 PE=2 SV=1
17	Q9Y7G6	6.0	30.4	1402	0.093	0.014	Q9Y7G6_NEUCS RNA-dependent RNA polymerase (Fragment) OS=Neurospora crassa OX=5141 GN=qde-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07989 Cnn_1N	4.3	18.9	Centrosomin N-terminal motif 1
2	PF01544 CorA	2.2e+02	12.5	CorA-like Mg2+ transporter protein
3	PF08848 DUF1818	5.1e+02	12.2	Domain of unknown function (DUF1818)
4	PF17432 DUF3458_C	18	16.2	Domain of unknown function (DUF3458_C) ARM repeats
5	PF04880 NUDE_C	0.94	21.4	NUDE protein, C-terminal conserved region
6	PF03938 OmpH	1.3e+02	14.3	Outer membrane protein (OmpH-like)
7	PF03213 Pox_P35	3.7e+02	11.7	Poxvirus P35 protein
8	PF04201 TPD52	7.4e-52	185.5	Tumour protein D52 family
9	PF15456 Uds1	89	14.7	Up-regulated During Septation
10	PF05701 WEMBL	20	15.4	Weak chloroplast movement under blue light

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000434142

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000429309	0.948	Belongs to the TPD52 family
2	9606.ENSP00000432083	0.902	Heat shock cognate 71 kDa protein
3	9606.ENSP00000349781	0.900	TBC1 domain family member 8B
4	9606.ENSP00000360108	0.900	Putative tyrosine-protein phosphatase auxilin
5	9606.ENSP00000447053	0.720	Ras-related protein Rab-5C
6	9606.ENSP00000479606	0.718	Clathrin heavy chain 1
7	9606.ENSP00000305976	0.679	Serine/threonine-protein kinase SIK2
8	9606.ENSP00000381981	0.655	E3 ubiquitin-protein ligase TTC3
9	9606.ENSP00000361930	0.639	14-3-3 protein beta/alpha
10	9606.ENSP00000366098	0.637	Protein YIF1A
11	9606.ENSP00000258739	0.635	ER lumen protein-retaining receptor 2
12	9606.ENSP00000263864	0.621	Vesicle-associated membrane protein 8
13	9606.ENSP00000314214	0.621	Vesicle-associated membrane protein 2
14	9606.ENSP00000225171	0.619	DnaJ heat shock protein family member C12
15	9606.ENSP00000262640	0.619	Vesicle-associated membrane protein 7
16	9606.ENSP00000349437	0.617	Cation-independent mannose-6-phosphate receptor
17	9606.ENSP00000254605	0.616	Ribosomal RNA-processing protein 8
18	9606.ENSP00000360154	0.613	Inositol polyphosphate 5-phosphatase OCRL-1
19	9606.ENSP00000373905	0.609	Dynamin-2
20	9606.ENSP00000440005	0.609	ADP-ribosylation factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0048522	0.971	positive regulation of cellular process
GO:0080090	0.949	regulation of primary metabolic process
GO:0060255	0.949	regulation of macromolecule metabolic process
GO:0051171	0.949	regulation of nitrogen compound metabolic process
GO:0031323	0.939	regulation of cellular metabolic process
GO:0050790	0.867	regulation of catalytic activity
GO:0048583	0.843	regulation of response to stimulus
GO:0010646	0.841	regulation of cell communication
GO:0051246	0.827	regulation of protein metabolic process
GO:0023051	0.823	regulation of signaling
GO:0009966	0.783	regulation of signal transduction
GO:0019220	0.762	regulation of phosphate metabolic process
GO:0042325	0.735	regulation of phosphorylation
GO:0031399	0.731	regulation of protein modification process
GO:0051338	0.701	regulation of transferase activity
GO:0001932	0.670	regulation of protein phosphorylation
GO:0045859	0.662	regulation of protein kinase activity
GO:0071900	0.643	regulation of protein serine/threonine kinase activity
GO:0043405	0.629	regulation of MAP kinase activity
GO:0048584	0.628	positive regulation of response to stimulus
GO:0043408	0.622	regulation of MAPK cascade
GO:0023056	0.620	positive regulation of signaling
GO:0010647	0.620	positive regulation of cell communication
GO:0009893	0.594	positive regulation of metabolic process
GO:0051179	0.571	localization
GO:0043085	0.551	positive regulation of catalytic activity
GO:0009967	0.538	positive regulation of signal transduction
GO:0051173	0.535	positive regulation of nitrogen compound metabolic process
GO:0010604	0.529	positive regulation of macromolecule metabolic process
GO:0051347	0.506	positive regulation of transferase activity
GO:0043410	0.504	positive regulation of MAPK cascade
GO:0031325	0.499	positive regulation of cellular metabolic process
GO:0051247	0.453	positive regulation of protein metabolic process
GO:0006810	0.402	transport
GO:0010941	0.391	regulation of cell death
GO:0071902	0.382	positive regulation of protein serine/threonine kinase activity
GO:0032874	0.362	positive regulation of stress-activated MAPK cascade
GO:0043406	0.352	positive regulation of MAP kinase activity
GO:0042981	0.348	regulation of apoptotic process
GO:0044839	0.338	cell cycle G2/M phase transition
GO:0044772	0.320	mitotic cell cycle phase transition
GO:0010942	0.310	positive regulation of cell death
GO:0050896	0.309	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0012505	0.996	endomembrane system
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0048471	0.988	perinuclear region of cytoplasm
GO:0031982	0.914	vesicle
GO:0031410	0.889	cytoplasmic vesicle
GO:0016020	0.828	membrane
GO:0005829	0.785	cytosol
GO:0005768	0.575	endosome
GO:0070013	0.373	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]