StarFunc result for job id Q17R89

User Input

>input (818 residues)
MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGA
EADKRSKKLPLTTLAQCLMEGSAILGDDTLLGKMLKLCGETEDKLAQELIHFELQVERDV
IEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALR
EEMEEAANRVEICRDQLSADMYSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQI
KAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEACVTMLLECGMQEEGLFRVAPSASKLK
KLKAALDCCVVDVQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNVQEQDKKL
QALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLLWPQAEGNIT
EMMTTVSLQIVGIIEPIIQHADWFFPGEIEFNITGNYGSPVHVNHNANYSSMPSPDMDPA
DRRQPEQARRPLSVATDNMMLEFYKKDGLRKIQSMGVRVMDTNWVARRGSSAGRKVSCAP
PSMQPPAPPAELAAPLPSPLPEQPLDSPAAPALSPSGLGLQPGPERTSTTKSKELSPGSA
QKGSPGSSQGTACAGTQPGAQPGAQPGASPSPSQPPADQSPHTLRKVSKKLAPIPPKVPF
GQPGAMADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFT
STLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMSTDLVHFDIP
SIHIELGSTLRLSPLEHMRRHSVTDKRDSEEESESTAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q17R89	0.999	0.999	1.463E-85	818	1.000	1.000	Q17R89.pdb.gz	RHG44_HUMAN Rho GTPase-activating protein 44 OS=Homo sapiens OX=9606 GN=ARHGAP44 PE=1 SV=1
2	AFDB:Q99N37	0.536	0.512	2.156E-45	858	0.490	0.467	Q99N37.pdb.gz	RHG17_RAT Rho GTPase-activating protein 17 OS=Rattus norvegicus OX=10116 GN=Arhgap17 PE=1 SV=1
3	AFDB:Q68EM7	0.528	0.492	7.889E-45	881	0.488	0.453	Q68EM7.pdb.gz	RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17 PE=1 SV=1
4	AFDB:A0A0A0MRJ9	0.228	0.210	6.199E-13	890	0.166	0.153	A0A0A0MRJ9.pdb.gz	A0A0A0MRJ9_HUMAN Rho GTPase activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=1
5	AFDB:Q8N264	0.246	0.268	2.777E-12	748	0.142	0.155	Q8N264.pdb.gz	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
6	AFDB:Q6DFV3	0.226	0.097	9.369E-12	1944	0.174	0.073	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
7	AFDB:Q5T5U3	0.227	0.096	2.688E-11	1958	0.160	0.067	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
8	AFDB:Q9VIS1	0.240	0.108	1.024E-10	1843	0.155	0.069	Q9VIS1.pdb.gz	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
9	AFDB:X2JEI9	0.228	0.087	2.937E-10	2206	0.138	0.051	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
10	PDB:1xa6A	0.228	0.458	3.504E-9	399	0.065	0.133	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
11	PDB:6r3vA	0.224	0.881	4.291E-9	198	0.072	0.298	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
12	PDB:3cxlA	0.229	0.458	7.267E-9	402	0.065	0.132	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
13	AFDB:O94988	0.230	0.185	1.083E-8	1023	0.121	0.097	O94988.pdb.gz	FA13A_HUMAN Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A PE=1 SV=2
14	PDB:5c2kA	0.211	0.437	9.725E-8	382	0.062	0.134	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
15	PDB:5jcpA	0.184	0.409	7.685E-7	361	0.044	0.100	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
16	PDB:6upnA	0.188	0.573	3.409E-2	245	0.059	0.196	6upnA.pdb.gz
17	PDB:6ikoA	0.147	0.296	5.324E-2	303	0.037	0.099	6ikoA.pdb.gz
18	PDB:3hajA	0.084	0.191	1.247E-1	286	0.042	0.119	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
19	PDB:7d6dA	0.197	0.376	2.921E-1	380	0.061	0.132	7d6dA.pdb.gz
20	PDB:2xgjB	0.075	0.078	4.040E-1	777	0.059	0.062	2xgjB.pdb.gz	Structural Analysis Reveals the Characteristic Features of Mtr4, a Dexh Helicase Involved in Nuclear RNA Processing and Surveillance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LQX4	0.0	1472	814	0.941	0.946	RHG44_RAT Rho GTPase-activating protein 44 OS=Rattus norvegicus OX=10116 GN=Arhgap44 PE=1 SV=2
2	Q17R89	0.0	1672	818	1.000	1.000	RHG44_HUMAN Rho GTPase-activating protein 44 OS=Homo sapiens OX=9606 GN=ARHGAP44 PE=1 SV=1
3	Q3UIA2	0.0	666	846	0.451	0.436	RHG17_MOUSE Rho GTPase-activating protein 17 OS=Mus musculus OX=10090 GN=Arhgap17 PE=1 SV=1
4	Q5SSM3	0.0	1467	814	0.939	0.943	RHG44_MOUSE Rho GTPase-activating protein 44 OS=Mus musculus OX=10090 GN=Arhgap44 PE=1 SV=1
5	Q68EM7	0.0	664	881	0.425	0.395	RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17 PE=1 SV=1
6	Q99N37	0.0	662	858	0.450	0.429	RHG17_RAT Rho GTPase-activating protein 17 OS=Rattus norvegicus OX=10116 GN=Arhgap17 PE=1 SV=1
7	D3ZFJ3	7.11e-143	439	689	0.281	0.334	3BP1_RAT SH3 domain-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Sh3bp1 PE=1 SV=1
8	P55194	3.86e-140	432	680	0.284	0.341	3BP1_MOUSE SH3 domain-binding protein 1 OS=Mus musculus OX=10090 GN=Sh3bp1 PE=1 SV=3
9	Q9Y3L3	6.24e-138	427	701	0.287	0.335	3BP1_HUMAN SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3
10	Q6ZT62	6.91e-126	394	677	0.264	0.319	BGIN_HUMAN Bargin OS=Homo sapiens OX=9606 GN=BARGIN PE=1 SV=2
11	Q9VDS5	3.43e-63	228	740	0.191	0.211	RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster OX=7227 GN=RhoGAP92B PE=1 SV=1
12	Q7Z5H3	6.21e-29	125	698	0.089	0.105	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
13	Q8C4V1	6.99e-29	125	747	0.084	0.092	RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus OX=10090 GN=Arhgap24 PE=1 SV=2
14	Q8N264	1.64e-28	124	748	0.084	0.092	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
15	Q9P227	1.32e-25	116	1491	0.073	0.040	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
16	F1MAK3	3.19e-25	115	2101	0.084	0.033	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
17	A0A8I5Y6H2	3.25e-25	115	2046	0.084	0.034	A0A8I5Y6H2_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
18	A0A8I6GIC6	3.34e-25	115	2061	0.084	0.033	A0A8I6GIC6_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
19	Q811P8	3.50e-25	115	2089	0.084	0.033	RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus OX=10090 GN=Arhgap32 PE=1 SV=2
20	A7KAX9	5.85e-25	114	2087	0.084	0.033	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03114 BAR	4e-63	224.8	BAR domain
2	PF16746 BAR_3	31	15.6	BAR domain of APPL family
3	PF06252 GemA	77	15.7	Bacteriophage Mu, GemA protein
4	PF00620 RhoGAP	8.1e-42	154.1	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368994

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262613	0.805	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
2	9606.ENSP00000320117	0.769	Cdc42-interacting protein 4
3	9606.ENSP00000252593	0.747	Bone marrow stromal antigen 2
4	9606.ENSP00000356042	0.736	Ezrin
5	9606.ENSP00000383118	0.722	Cell division control protein 42 homolog
6	9606.ENSP00000289968	0.697	Rho GTPase-activating protein 17
7	9606.ENSP00000350018	0.694	SH3 domain-binding protein 1
8	9606.ENSP00000454748	0.658	Leucine-rich repeat-containing protein 9
9	9606.ENSP00000348459	0.589	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
10	9606.ENSP00000416696	0.589	RAB6A-GEF complex partner protein 1
11	9606.ENSP00000046794	0.564	Lymphocyte cytosolic protein 2
12	9606.ENSP00000258145	0.554	N-acetylglucosamine-6-sulfatase
13	9606.ENSP00000471502	0.553	Leucine-rich repeat-containing protein 4B
14	9606.ENSP00000328083	0.552	Rho guanine nucleotide exchange factor 37
15	9606.ENSP00000315137	0.537	Sphingosine-1-phosphate phosphatase 2
16	9606.ENSP00000220822	0.520	Ganglioside-induced differentiation-associated protein 1
17	9606.ENSP00000348461	0.505	Ras-related C3 botulinum toxin substrate 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0005543	0.904	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051128	0.947	regulation of cellular component organization
GO:0048523	0.946	negative regulation of cellular process
GO:0009987	0.942	cellular process
GO:0043087	0.879	regulation of GTPase activity
GO:0048583	0.872	regulation of response to stimulus
GO:1902531	0.856	regulation of intracellular signal transduction
GO:0051056	0.817	regulation of small GTPase mediated signal transduction
GO:0051234	0.768	establishment of localization
GO:0006810	0.758	transport
GO:0071840	0.514	cellular component organization or biogenesis
GO:0050896	0.464	response to stimulus
GO:0016043	0.460	cellular component organization
GO:0051716	0.412	cellular response to stimulus
GO:0007154	0.344	cell communication
GO:0031344	0.332	regulation of cell projection organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0016020	0.999	membrane
GO:0005829	0.995	cytosol
GO:0043226	0.992	organelle
GO:0005886	0.992	plasma membrane
GO:0043229	0.928	intracellular organelle
GO:0120025	0.885	plasma membrane bounded cell projection
GO:0030054	0.818	cell junction
GO:0043227	0.797	membrane-bounded organelle
GO:0043231	0.792	intracellular membrane-bounded organelle
GO:0045202	0.544	synapse
GO:0043005	0.544	neuron projection
GO:0031252	0.508	cell leading edge
GO:0098794	0.430	postsynapse
GO:0036477	0.427	somatodendritic compartment
GO:0030425	0.396	dendrite
GO:0098978	0.370	glutamatergic synapse
GO:0031256	0.356	leading edge membrane
GO:0012505	0.343	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]