StarFunc result for job id Q17R98

User Input

>input (1081 residues)
MPRRKQEQPKRLPSHVSRQEEAEGELSEGEHWYGNSSETPSEASYGEVQENYKLSLEDRI
QEQSTSPDTSLGSTTPSSHTLELVALDSEVLRDSLQCQDHLSPGVSSLCDDDPGSNKPLS
SNLRRLLEAGSLKLDAAATANGRVESPVNVGSNLSFSPPSHHAQQLSVLARKLAEKQEQN
DQYTPSNRFIWNQGKWLPNSTTTCSLSPDSAILKLKAAANAVLQDKSLTRTEETMRFESF
SSPFSSQSASSTLAALSKKVSERSLTPGQEHPPPASSFLSLASMTSSAALLKEVAARAAG
SLLAEKSSLLPEDPLPPPPSEKKPEKVTPPPPPPPPPPPPPPPQSLELLLLPVPKGRVSK
PSNSASEEESGKPFQCPICGLVIKRKSYWKRHMVIHTGLKSHQCPLCPFRCARKDNLKSH
MKVHQHQDRGETFQCQLCPFTSSRHFSLKLHMRCHQHFLRTEAKVKEEIPDPDVKGSPHL
SDSACLGQQREGGGTELVGTMMTSNTPERTSQGGAGVSPLLVKEEPKEDNGLPTSFTLNA
ADRPANHTKLKDPSEYVANSASALFSQDISVKMASDFLMKLSAANQKEPMNLNFKVKEEP
KEGESLSTTLPRSSYVFSPESEVSAPGVSEDALKPQEGKGSVLRRDVSVKAASELLMKLS
AESYKETQMVKIKEEPMEVDIQDSHVSISPSRNVGYSTLIGREKTEPLQKMPEGRVPPER
NLFSQDISVKMASELLFQLSEKVSKEHNHTKENTIRTTTSPFFSEDTFRQSPFTSNSKEL
LPSDSVLHGRISAPETEKIVLEAGNGLPSWKFNDQLFPCDVCGKVFGRQQTLSRHLSLHT
EERKYKCHLCPYAAKCRANLNQHLTVHSVKLVSTDTEDIVSAVTSEGSDGKKHPYYYSCH
VCGFETELNVQFVSHMSLHVDKEQWMFSICCTACDFVTMEEAEIKTHIGTKHTGEDRKTP
SESNSPSSSSLSALSDSANSKDDSDGSQKNKGGNNLLVISVMPGSQPSLNSEEKPEKGFE
CVFCNFVCKTKNMFERHLQIHLITRMFECDVCHKFMKTPEQLLEHKKCHTVPTGGLNSGQ
W

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q17R98	1.000	1.000	0.000	1081	1.000	1.000	Q17R98.pdb.gz	ZN827_HUMAN Zinc finger protein 827 OS=Homo sapiens OX=9606 GN=ZNF827 PE=1 SV=1
2	AFDB:Q5EXX3	0.066	0.062	2.633E-12	1203	0.167	0.150	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
3	AFDB:Q62255	0.062	0.051	6.339E-12	1320	0.193	0.158	Q62255.pdb.gz	SALL3_MOUSE Sal-like protein 3 OS=Mus musculus OX=10090 GN=Sall3 PE=1 SV=2
4	AFDB:A0A0R4INF0	0.071	0.052	7.463E-10	1570	0.171	0.118	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
5	AFDB:D9YZW0	0.071	0.086	8.461E-10	835	0.165	0.213	D9YZW0.pdb.gz	D9YZW0_HUMAN B-cell CLL/lymphoma 11A (Zinc finger protein), isoform CRA_b OS=Homo sapiens OX=9606 GN=BCL11A PE=4 SV=1
6	AFDB:A2BIH4	0.060	0.058	3.160E-9	1169	0.162	0.150	A2BIH4.pdb.gz	A2BIH4_DANRE Zinc finger protein 644a OS=Danio rerio OX=7955 GN=fi40c02 PE=4 SV=1
7	AFDB:Q9VPQ6	0.059	0.056	3.364E-9	1191	0.151	0.137	Q9VPQ6.pdb.gz	USH_DROME Zinc finger protein ush OS=Drosophila melanogaster OX=7227 GN=ush PE=1 SV=2
8	AFDB:Q92610	0.053	0.048	4.324E-9	1267	0.151	0.129	Q92610.pdb.gz	ZN592_HUMAN Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2
9	AFDB:Q7Z4V0	0.067	0.080	1.517E-8	828	0.141	0.184	Q7Z4V0.pdb.gz	ZN438_HUMAN Zinc finger protein 438 OS=Homo sapiens OX=9606 GN=ZNF438 PE=1 SV=1
10	AFDB:Q5BIH1	0.063	0.081	3.961E-7	803	0.119	0.161	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
11	PDB:3w5kB	0.048	0.284	2.892E-2	110	0.024	0.236	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6zxfy	0.028	0.101	2.195	233	0.008	0.039	6zxfy.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
13	PDB:3j6bW	0.029	0.136	4.110	112	0.012	0.116	3j6bW.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
14	PDB:7oqyY	0.025	0.143	4.660	92	0.021	0.250	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
15	PDB:6cvlD	0.026	0.067	7.230	344	0.004	0.012	6cvlD.pdb.gz	Noncanonical role for the binding protein in substrate uptake by the MetNI methionine ATP Binding Cassette (ABC) transporter.
16	PDB:7pzy0	0.030	0.097	8.196	171	0.012	0.076	7pzy0.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
17	PDB:1sb7B	0.038	0.084	8.727	344	0.008	0.026	1sb7B.pdb.gz
18	PDB:7ns4i	0.038	0.087	9.292	358	0.018	0.053	7ns4i.pdb.gz	GID E3 ligase supramolecular chelate assembly configures multipronged ubiquitin targeting of an oligomeric metabolic enzyme.
19	PDB:2jr7A	0.024	0.143	9.893	84	0.008	0.107	2jr7A.pdb.gz	Solution structure of human DESR1, a CSL zinc-binding protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q17R98	0.0	2221	1081	1.000	1.000	ZN827_HUMAN Zinc finger protein 827 OS=Homo sapiens OX=9606 GN=ZNF827 PE=1 SV=1
2	Q99KE8	2.06e-13	77.0	643	0.057	0.096	ZFP64_MOUSE Zinc finger protein 64 OS=Mus musculus OX=10090 GN=Zfp64 PE=1 SV=1
3	Q9NTW7	3.38e-13	76.3	645	0.057	0.096	ZF64B_HUMAN Zinc finger protein 64 OS=Homo sapiens OX=9606 GN=ZFP64 PE=1 SV=3
4	Q8NCP5	4.42e-13	75.9	570	0.040	0.075	ZBT44_HUMAN Zinc finger and BTB domain-containing protein 44 OS=Homo sapiens OX=9606 GN=ZBTB44 PE=1 SV=1
5	P17023	7.52e-13	74.3	458	0.067	0.157	ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens OX=9606 GN=ZNF19 PE=1 SV=4
6	Q8VIG1	9.75e-13	75.1	1082	0.038	0.038	REST_MOUSE RE1-silencing transcription factor OS=Mus musculus OX=10090 GN=Rest PE=1 SV=2
7	Q9VS55	2.11e-12	73.9	818	0.032	0.043	Q9VS55_DROME CTCF OS=Drosophila melanogaster OX=7227 GN=CTCF PE=1 SV=2
8	Q8TA44	2.18e-12	73.9	818	0.032	0.043	Q8TA44_DROME CTCF OS=Drosophila melanogaster OX=7227 GN=CTCF PE=1 SV=1
9	Q13127	3.57e-12	73.6	1097	0.038	0.037	REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=3
10	O54963	1.71e-11	71.2	1069	0.037	0.037	REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus OX=10116 GN=Rest PE=1 SV=1
11	O95365	4.47e-11	69.3	584	0.031	0.058	ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1
12	P16373	4.83e-11	69.3	653	0.063	0.104	ZFP59_MOUSE Zinc finger protein 59 OS=Mus musculus OX=10090 GN=Zfp59 PE=1 SV=3
13	Q9QZ48	4.87e-11	68.9	569	0.031	0.060	ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus OX=10116 GN=Zbtb7a PE=1 SV=1
14	O88939	5.64e-11	68.9	569	0.031	0.060	ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus OX=10090 GN=Zbtb7a PE=1 SV=2
15	Q9HC78	7.68e-11	68.9	741	0.034	0.050	ZBT20_HUMAN Zinc finger and BTB domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZBTB20 PE=1 SV=3
16	M9PBR0	7.97e-11	68.9	1216	0.028	0.025	M9PBR0_DROME Blimp-1, isoform B OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=4 SV=1
17	Q9VRN4	8.01e-11	68.9	1203	0.028	0.025	Q9VRN4_DROME Blimp-1, isoform A OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=2 SV=1
18	Q8K0L9	8.51e-11	68.6	741	0.034	0.050	ZBT20_MOUSE Zinc finger and BTB domain-containing protein 20 OS=Mus musculus OX=10090 GN=Zbtb20 PE=1 SV=1
19	Q96PQ6	1.15e-10	68.2	595	0.097	0.176	ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens OX=9606 GN=ZNF317 PE=1 SV=2
20	Q8N8E2	1.46e-10	67.4	541	0.029	0.057	ZN513_HUMAN Zinc finger protein 513 OS=Homo sapiens OX=9606 GN=ZNF513 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09237 GAGA	4.9e+02	12.2	GAGA factor
2	PF02881 SRP54_N	2.4e+02	13.3	SRP54-type protein, helical bundle domain
3	PF00096 zf-C2H2	1.1e-11	55.6	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	0.00034	32.2	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	3.7	18.9	C2H2-type zinc finger
6	PF13465 zf-H2C2_2	0.067	24.9	Zinc-finger double domain
7	PF13909 zf-H2C2_5	2.1e-06	38.6	C2H2-type zinc-finger domain
8	PF12874 zf-met	1.8e+02	13.9	Zinc-finger of C2H2 type
9	PF17772 zf-MYST	1.1e+02	13.9	MYST family zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000014628

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000010915	0.820	RB binding protein 7, chromatin remodeling factor
2	60711.ENSCSAP00000000019	0.686	Nuclear receptor subfamily 2, group C, member 1
3	60711.ENSCSAP00000016385	0.675	DNA cross-link repair 1B
4	60711.ENSCSAP00000010131	0.669	Nuclear apoptosis inducing factor 1
5	60711.ENSCSAP00000015259	0.669	Zinc finger protein 276
6	60711.ENSCSAP00000009513	0.663	S1 RNA binding domain 1
7	60711.ENSCSAP00000008849	0.661	Fibrinogen silencer binding protein
8	60711.ENSCSAP00000002326	0.651	annotation not available
9	60711.ENSCSAP00000018417	0.650	Zinc finger and BTB domain containing 39
10	60711.ENSCSAP00000005162	0.648	Zinc finger protein 692
11	60711.ENSCSAP00000015015	0.647	Ring finger protein 166
12	60711.ENSCSAP00000002346	0.643	Family with sequence similarity 83, member F
13	60711.ENSCSAP00000009762	0.639	Telomeric repeat binding factor (NIMA-interacting) 1
14	60711.ENSCSAP00000007844	0.606	Ubiquitin-like modifier activating enzyme 3
15	60711.ENSCSAP00000015721	0.570	Replication factor C (activator 1) 5, 36.5kDa
16	60711.ENSCSAP00000004499	0.564	G1 to S phase transition 1
17	60711.ENSCSAP00000001256	0.535	annotation not available
18	60711.ENSCSAP00000012398	0.529	RAB28, member RAS oncogene family
19	60711.ENSCSAP00000000950	0.527	Regulatory subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M.
20	60711.ENSCSAP00000011974	0.524	Homeobox containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0003676	0.940	nucleic acid binding
GO:0003677	0.923	DNA binding
GO:0043565	0.823	sequence-specific DNA binding
GO:0003690	0.769	double-stranded DNA binding
GO:1990837	0.726	sequence-specific double-stranded DNA binding
GO:0140110	0.709	transcription regulator activity
GO:0120325	0.530	NuRD complex binding
GO:0003700	0.481	DNA-binding transcription factor activity
GO:0001067	0.358	transcription regulatory region nucleic acid binding
GO:0000976	0.348	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0080090	0.993	regulation of primary metabolic process
GO:0051171	0.993	regulation of nitrogen compound metabolic process
GO:0031323	0.993	regulation of cellular metabolic process
GO:0010468	0.992	regulation of gene expression
GO:0010556	0.981	regulation of macromolecule biosynthetic process
GO:0031326	0.981	regulation of cellular biosynthetic process
GO:0019219	0.980	regulation of nucleobase-containing compound metabolic process
GO:0071704	0.953	organic substance metabolic process
GO:0006355	0.945	regulation of DNA-templated transcription
GO:0043170	0.932	macromolecule metabolic process
GO:0048519	0.927	negative regulation of biological process
GO:0044238	0.923	primary metabolic process
GO:0010605	0.922	negative regulation of macromolecule metabolic process
GO:0006807	0.916	nitrogen compound metabolic process
GO:0045934	0.916	negative regulation of nucleobase-containing compound metabolic process
GO:0045892	0.905	negative regulation of DNA-templated transcription
GO:0071840	0.859	cellular component organization or biogenesis
GO:0016043	0.849	cellular component organization
GO:0090304	0.835	nucleic acid metabolic process
GO:0044260	0.718	cellular macromolecule metabolic process
GO:0006259	0.694	DNA metabolic process
GO:0006325	0.423	chromatin organization
GO:0048518	0.405	positive regulation of biological process
GO:0006338	0.382	chromatin remodeling
GO:0051128	0.347	regulation of cellular component organization
GO:0048522	0.323	positive regulation of cellular process
GO:0009893	0.308	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005634	0.996	nucleus
GO:0031974	0.995	membrane-enclosed lumen
GO:0005654	0.994	nucleoplasm
GO:0032991	0.987	protein-containing complex
GO:0005694	0.981	chromosome
GO:0000781	0.923	chromosome, telomeric region
GO:0005737	0.804	cytoplasm
GO:0000785	0.708	chromatin
GO:1990904	0.504	ribonucleoprotein complex
GO:0005829	0.438	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]