StarFunc result for job id Q17RS7

User Input

>input (908 residues)
MGVNDLWQILEPVKQHIPLRNLGGKTIAVDLSLWVCEAQTVKKMMGSVMKPHLRNLFFRI
SYLTQMDVKLVFVMEGEPPKLKADVISKRNQSRYGSSGKSWSQKTGRSHFKSVLRECLHM
LECLGIPWVQAAGEAEAMCAYLNAGGHVDGCLTNDGDTFLYGAQTVYRNFTMNTKDPHVD
CYTMSSIKSKLGLDRDALVGLAILLGCDYLPKGVPGVGKEQALKLIQILKGQSLLQRFNR
WNETSCNSSPQLLVTKKLAHCSVCSHPGSPKDHERNGCRLCKSDKYCEPHDYEYCCPCEW
HRTEHDRQLSEVENNIKKKACCCEGFPFHEVIQEFLLNKDKLVKVIRYQRPDLLLFQRFT
LEKMEWPNHYACEKLLVLLTHYDMIERKLGSRNSNQLQPIRIVKTRIRNGVHCFEIEWEK
PEHYAMEDKQHGEFALLTIEEESLFEAAYPEIVAVYQKQKLEIKGKKQKRIKPKENNLPE
PDEVMSFQSHMTLKPTCEIFHKQNSKLNSGISPDPTLPQESISASLNSLLLPKNTPCLNA
QEQFMSSLRPLAIQQIKAVSKSLISESSQPNTSSHNISVIADLHLSTIDWEGTSFSNSPA
IQRNTFSHDLKSEVESELSAIPDGFENIPEQLSCESERYTANIKKVLDEDSDGISPEEHL
LSGITDLCLQDLPLKERIFTKLSYPQDNLQPDVNLKTLSILSVKESCIANSGSDCTSHLS
KDLPGIPLQNESRDSKILKGDQLLQEDYKVNTSVPYSVSNTVVKTCNVRPPNTALDHSRK
VDMQTTRKILMKKSVCLDRHSSDEQSAPVFGKAKYTTQRMKHSSQKHNSSHFKESGHNKL
SSPKIHIKETEQCVRSYETAENEESCFPDSTKSSLSSLQCHKKENNSGTCLDSPLPLRQR
LKLRFQST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q17RS7	1.000	1.000	0.000	908	1.000	1.000	Q17RS7.pdb.gz	GEN_HUMAN Flap endonuclease GEN homolog 1 OS=Homo sapiens OX=9606 GN=GEN1 PE=1 SV=2
2	AFDB:Q54ED2	0.232	0.203	8.763E-14	1046	0.159	0.138	Q54ED2.pdb.gz	EXO1_DICDI Exonuclease 1 OS=Dictyostelium discoideum OX=44689 GN=exo1 PE=3 SV=1
3	PDB:1ul1Z	0.274	0.670	1.693E-13	349	0.091	0.238	1ul1Z.pdb.gz	Structural basis for recruitment of human flap endonuclease 1 to PCNA
4	PDB:1ul1X	0.213	0.581	2.456E-13	313	0.093	0.268	1ul1X.pdb.gz	Structural basis for recruitment of human flap endonuclease 1 to PCNA
5	AFDB:Q9ATY5	0.228	0.147	7.085E-11	1479	0.130	0.080	Q9ATY5.pdb.gz	UVH3_ARATH DNA repair protein UVH3 OS=Arabidopsis thaliana OX=3702 GN=UVH3 PE=2 SV=1
6	PDB:5hnkA	0.179	0.497	4.566E-6	272	0.043	0.143	5hnkA.pdb.gz	Direct observation of DNA threading in flap endonuclease complexes.
7	PDB:1xo1A	0.157	0.478	1.550E-5	245	0.042	0.155	1xo1A.pdb.gz
8	AFDB:Q99549	0.072	0.076	9.921E-3	860	0.085	0.090	Q99549.pdb.gz	MPP8_HUMAN M-phase phosphoprotein 8 OS=Homo sapiens OX=9606 GN=MPHOSPH8 PE=1 SV=2
9	PDB:2j5tH	0.089	0.207	6.170E-2	337	0.023	0.062	2j5tH.pdb.gz	A Novel Two-Domain Architecture within the Amino Acid Kinase Enzyme Family Revealed by the Crystal Structure of Escherichia Coli Glutamate 5-Kinase.
10	PDB:2j5tD	0.076	0.170	1.231E-1	365	0.025	0.063	2j5tD.pdb.gz	A Novel Two-Domain Architecture within the Amino Acid Kinase Enzyme Family Revealed by the Crystal Structure of Escherichia Coli Glutamate 5-Kinase.
11	PDB:2bneB	0.077	0.260	3.204E-1	238	0.019	0.071	2bneB.pdb.gz	Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
12	PDB:2c44C	0.063	0.099	3.563E-1	468	0.039	0.075	2c44C.pdb.gz	Structure of Escherichia Coli Tryptophanase
13	PDB:2v5hB	0.047	0.124	4.179E-1	289	0.019	0.059	2v5hB.pdb.gz	The Crystal Structure of the Complex of Pii and Acetylglutamate Kinase Reveals How Pii Controls the Storage of Nitrogen as Arginine.
14	PDB:5cgzA	0.096	0.285	4.179E-1	240	0.036	0.138	5cgzA.pdb.gz	Structural and Kinetic Characterization of the 4-Carboxy-2-hydroxymuconate Hydratase from the Gallate and Protocatechuate 4,5-Cleavage Pathways of Pseudomonas putida KT2440.
15	AFDB:Q9D8C3	0.051	0.042	1.389	1166	0.112	0.087	Q9D8C3.pdb.gz	ALG13_MOUSE Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Mus musculus OX=10090 GN=Alg13 PE=1 SV=2
16	AFDB:Q96AV8	0.046	0.046	2.125	911	0.123	0.123	Q96AV8.pdb.gz	E2F7_HUMAN Transcription factor E2F7 OS=Homo sapiens OX=9606 GN=E2F7 PE=1 SV=3
17	AFDB:A0A0B4LFW8	0.044	0.036	2.241	1277	0.113	0.081	A0A0B4LFW8.pdb.gz	A0A0B4LFW8_DROME Thin, isoform E OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
18	AFDB:Q96M83	0.058	0.043	2.241	1385	0.138	0.090	Q96M83.pdb.gz	CCDC7_HUMAN Coiled-coil domain-containing protein 7 OS=Homo sapiens OX=9606 GN=CCDC7 PE=1 SV=3
19	AFDB:A0A0S2Z5B2	0.062	0.096	2.492	560	0.073	0.118	A0A0S2Z5B2.pdb.gz	A0A0S2Z5B2_HUMAN Chromobox homolog 4 (Pc class homolog, Drosophila), isoform CRA_a (Fragment) OS=Homo sapiens OX=9606 GN=CBX4 PE=2 SV=1
20	AFDB:F5H7T0	0.048	0.048	2.492	854	0.116	0.123	F5H7T0.pdb.gz	F5H7T0_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=RPS6KC1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q17RS7	0.0	1883	908	1.000	1.000	GEN_HUMAN Flap endonuclease GEN homolog 1 OS=Homo sapiens OX=9606 GN=GEN1 PE=1 SV=2
2	Q9VRJ0	2.56e-73	258	726	0.188	0.236	GEN_DROME Flap endonuclease GEN OS=Drosophila melanogaster OX=7227 GN=Gen PE=1 SV=1
3	Q64MA3	4.46e-59	215	629	0.156	0.226	GENL1_ORYSJ Flap endonuclease GEN-like 1 OS=Oryza sativa subsp. japonica OX=39947 GN=RAD PE=1 SV=1
4	Q9LPD2	2.21e-56	207	599	0.163	0.247	GENL1_ARATH Flap endonuclease GEN-like 1 OS=Arabidopsis thaliana OX=3702 GN=GEN1 PE=1 SV=3
5	Q9M2Z3	1.98e-39	157	600	0.107	0.162	GENL2_ARATH Single-strand DNA endonuclease 1 OS=Arabidopsis thaliana OX=3702 GN=SEND1 PE=1 SV=2
6	Q9ATY5	5.31e-27	121	1479	0.089	0.055	UVH3_ARATH DNA repair protein UVH3 OS=Arabidopsis thaliana OX=3702 GN=UVH3 PE=2 SV=1
7	Q5XIP6	3.22e-24	108	380	0.077	0.184	FEN1_RAT Flap endonuclease 1 OS=Rattus norvegicus OX=10116 GN=Fen1 PE=2 SV=1
8	P39748	5.48e-23	104	380	0.077	0.184	FEN1_HUMAN Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1
9	Q6FHX6	5.48e-23	104	380	0.077	0.184	Q6FHX6_HUMAN Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=2 SV=1
10	P39749	8.45e-22	100	378	0.076	0.183	FEN1_MOUSE Flap endonuclease 1 OS=Mus musculus OX=10090 GN=Fen1 PE=1 SV=1
11	Q6TNU4	4.65e-21	98.6	380	0.074	0.176	FEN1A_DANRE Flap endonuclease 1 OS=Danio rerio OX=7955 GN=fen1 PE=2 SV=1
12	P28715	6.75e-21	101	1186	0.057	0.044	ERCC5_HUMAN DNA excision repair protein ERCC-5 OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3
13	P35689	1.56e-20	100	1170	0.056	0.044	ERCC5_MOUSE DNA excision repair protein ERCC-5 OS=Mus musculus OX=10090 GN=Ercc5 PE=1 SV=4
14	P70054	7.79e-20	94.7	382	0.073	0.173	FEN1B_XENLA Flap endonuclease 1-B OS=Xenopus laevis OX=8355 GN=fen1-b PE=1 SV=1
15	F4K191	1.83e-19	94.7	453	0.076	0.152	F4K191_ARATH Flap endonuclease 1 OS=Arabidopsis thaliana OX=3702 GN=SAV6 PE=1 SV=1
16	P70040	2.56e-19	93.2	382	0.073	0.173	FEN1A_XENLA Flap endonuclease 1-A OS=Xenopus laevis OX=8355 GN=fen1-a PE=1 SV=1
17	P39750	4.38e-19	92.8	380	0.081	0.195	FEN1_SCHPO Flap endonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad2 PE=1 SV=1
18	Q4U2Q3	4.84e-19	95.5	1236	0.065	0.048	Q4U2Q3_DROME XPG OS=Drosophila melanogaster OX=7227 GN=mus201 PE=2 SV=1
19	Q4U2Q5	5.10e-19	95.5	1236	0.065	0.048	Q4U2Q5_DROME FI23547p1 OS=Drosophila melanogaster OX=7227 GN=mus201 PE=2 SV=1
20	Q4U2Q2	5.23e-19	95.5	1257	0.065	0.047	Q4U2Q2_DROME XPG variant OS=Drosophila melanogaster OX=7227 GN=mus201 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18704 Chromo_2	3.9e-17	73.5	Chromatin organization modifier domain 2
2	PF12105 SpoU_methylas_C	2.3e+02	12.9	SpoU, rRNA methylase, C-terminal
3	PF00867 XPG_I	9.3e-23	91.8	XPG I-region
4	PF00752 XPG_N	1.3e-09	49.7	XPG N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318977

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351185	0.994	DNA replication ATP-dependent helicase/nuclease DNA2
2	9606.ENSP00000442336	0.993	DNA topoisomerase 3-alpha
3	9606.ENSP00000451974	0.987	DNA repair protein XRCC3
4	9606.ENSP00000325863	0.986	Double-strand break repair protein MRE11
5	9606.ENSP00000317039	0.985	RecQ-mediated genome instability protein 1
6	9606.ENSP00000310356	0.984	RecQ-mediated genome instability protein 2
7	9606.ENSP00000372088	0.981	DNA repair protein RAD51 homolog 1
8	9606.ENSP00000298139	0.980	Werner syndrome ATP-dependent helicase
9	9606.ENSP00000307853	0.979	Crossover junction endonuclease MUS81
10	9606.ENSP00000355506	0.976	Exonuclease 1
11	9606.ENSP00000368100	0.975	DNA repair protein RAD50
12	9606.ENSP00000419471	0.970	DNA repair protein RAD51 homolog 2
13	9606.ENSP00000336701	0.969	DNA repair protein RAD51 homolog 3
14	9606.ENSP00000278616	0.963	Serine-protein kinase ATM
15	9606.ENSP00000347232	0.960	Bloom syndrome protein
16	9606.ENSP00000369497	0.960	Breast cancer type 2 susceptibility protein
17	9606.ENSP00000352271	0.953	DNA repair protein XRCC2
18	9606.ENSP00000382628	0.949	DNA endonuclease RBBP8
19	9606.ENSP00000418960	0.949	Breast cancer type 1 susceptibility protein
20	9606.ENSP00000261584	0.945	Partner and localizer of BRCA2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0000287	1.000	magnesium ion binding
GO:0000400	1.000	four-way junction DNA binding
GO:0008821	1.000	crossover junction DNA endonuclease activity
GO:0017108	1.000	5'-flap endonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0090304	0.997	nucleic acid metabolic process
GO:0006950	0.995	response to stress
GO:0044260	0.995	cellular macromolecule metabolic process
GO:0006259	0.993	DNA metabolic process
GO:0051716	0.986	cellular response to stimulus
GO:0006974	0.984	cellular response to DNA damage stimulus
GO:0050789	0.977	regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0006302	0.965	double-strand break repair
GO:0048522	0.945	positive regulation of cellular process
GO:0006260	0.919	DNA replication
GO:0006310	0.893	DNA recombination
GO:0006261	0.859	DNA-templated DNA replication
GO:0010564	0.807	regulation of cell cycle process
GO:0000724	0.642	double-strand break repair via homologous recombination
GO:1901987	0.565	regulation of cell cycle phase transition
GO:0051128	0.544	regulation of cellular component organization
GO:0033044	0.523	regulation of chromosome organization
GO:1901990	0.479	regulation of mitotic cell cycle phase transition
GO:0048583	0.468	regulation of response to stimulus
GO:0031297	0.455	replication fork processing
GO:0045787	0.448	positive regulation of cell cycle
GO:0090068	0.442	positive regulation of cell cycle process
GO:0048584	0.422	positive regulation of response to stimulus
GO:1902531	0.346	regulation of intracellular signal transduction
GO:0006312	0.344	mitotic recombination
GO:0032886	0.343	regulation of microtubule-based process
GO:0051983	0.343	regulation of chromosome segregation
GO:0051783	0.340	regulation of nuclear division
GO:1902533	0.335	positive regulation of intracellular signal transduction
GO:0007088	0.308	regulation of mitotic nuclear division

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0005813	0.991	centrosome
GO:0005694	0.744	chromosome
GO:0032991	0.453	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.21.-	1.000	Endodeoxyribonucleases producing 5'-phosphomonoesters.
EC:3.1.21.10	1.000	crossover junction endodeoxyribonuclease.

[back to server]