StarFunc result for job id Q18PE1

User Input

>input (504 residues)
MTEAALVEGQVKLRDGKKWKSRWLVLRKPSPVADCLLMLVYKDKSERIKGLRERSSLTLE
DICGLEPGLPYEGLVHTLAIVCLSQAIMLGFDSHEAMCAWDARIRYALGEVHRFHVTVAP
GTKLESGPATLHLCNDVLVLARDIPPAVTGQWKLSDLRRYGAVPSGFIFEGGTRCGYWAG
VFFLSSAEGEQISFLFDCIVRGISPTKGPFGLRPVLPDPSPPGPSTVEERVAQEALETLQ
LEKRLSLLSHAGRPGSGGDDRSLSSSSSEASHLDVSASSRLTAWPEQSSSSASTSQEGPR
PAAAQAAGEAMVGASRPPPKPLRPRQLQEVGRQSSSDSGIATGSHSSYSSSLSSYAGSSL
DVWRATDELGSLLSLPAAGAPEPSLCTCLPGTVEYQVPTSLRAHYDTPRSLCLAPRDHSP
PSQGSPGNSAARDSGGQTSAGCPSGWLGTRRRGLVMEAPQGSEATLPGPAPGEPWEAGGP
HAGPPPAFFSACPVCGGLKVNPPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q18PE1	1.000	1.000	4.393E-80	504	1.000	1.000	Q18PE1.pdb.gz	DOK7_HUMAN Protein Dok-7 OS=Homo sapiens OX=9606 GN=DOK7 PE=1 SV=1
2	AFDB:Q18PE0	0.615	0.615	6.056E-69	504	0.853	0.853	Q18PE0.pdb.gz	DOK7_MOUSE Protein Dok-7 OS=Mus musculus OX=10090 GN=Dok7 PE=1 SV=1
3	AFDB:F1R1E6	0.469	0.490	5.617E-47	480	0.518	0.544	F1R1E6.pdb.gz
4	AFDB:F6P2Z4	0.460	0.339	2.562E-44	695	0.542	0.393	F6P2Z4.pdb.gz
5	AFDB:F1QHL0	0.207	0.119	1.453E-10	1032	0.169	0.082	F1QHL0.pdb.gz
6	AFDB:Q9DF49	0.202	0.117	4.143E-10	1074	0.165	0.077	Q9DF49.pdb.gz	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
7	PDB:7c3mA	0.147	0.130	3.130E-6	577	0.058	0.050	7c3mA.pdb.gz
8	PDB:3ljuX	0.240	0.307	1.388E-5	373	0.067	0.091	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
9	PDB:6r9tA	0.171	0.044	2.189E-4	2185	0.052	0.012	6r9tA.pdb.gz
10	PDB:7rx9A	0.145	0.167	6.596E-4	432	0.024	0.028	7rx9A.pdb.gz
11	PDB:6xtbE	0.138	0.267	9.184E-4	235	0.050	0.106	6xtbE.pdb.gz
12	PDB:6hhgA	0.170	0.215	1.780E-3	386	0.054	0.070	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
13	AFDB:F4KB17	0.120	0.082	2.233E-3	839	0.139	0.083	F4KB17.pdb.gz	KTN83_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3 OS=Arabidopsis thaliana OX=3702 GN=KTN80.3 PE=1 SV=1
14	PDB:6upkH	0.160	0.185	2.619E-3	411	0.054	0.066	6upkH.pdb.gz	FACT caught in the act of manipulating the nucleosome.
15	PDB:6s9wA	0.161	0.193	3.647E-3	411	0.046	0.056	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
16	AFDB:D3ZAL7	0.191	0.143	5.107E-3	693	0.194	0.141	D3ZAL7.pdb.gz	D3ZAL7_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=3
17	PDB:6bbpA	0.148	0.144	5.670E-3	520	0.038	0.037	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
18	PDB:3uzsA	0.170	0.142	6.331E-3	609	0.038	0.031	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
19	AFDB:Q8TC56	0.146	0.125	6.368E-3	605	0.149	0.124	Q8TC56.pdb.gz	GAR3_HUMAN Golgi-associated RAB2 interactor protein 3 OS=Homo sapiens OX=9606 GN=GARIN3 PE=1 SV=2
20	AFDB:Q54Z52	0.152	0.100	1.106E-2	822	0.103	0.063	Q54Z52.pdb.gz	Q54Z52_DICDI Prespore-specific protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277777 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y701	0.0	627	464	0.651	0.707	A0A2R8Y701_HUMAN Docking protein 7 OS=Homo sapiens OX=9606 GN=DOK7 PE=1 SV=1
2	Q18PE0	0.0	801	504	0.853	0.853	DOK7_MOUSE Protein Dok-7 OS=Mus musculus OX=10090 GN=Dok7 PE=1 SV=1
3	Q18PE1	0.0	1004	504	1.000	1.000	DOK7_HUMAN Protein Dok-7 OS=Homo sapiens OX=9606 GN=DOK7 PE=1 SV=1
4	A0A1W2PRA3	2.06e-132	383	194	0.385	1.000	A0A1W2PRA3_HUMAN Docking protein 7 OS=Homo sapiens OX=9606 GN=DOK7 PE=1 SV=1
5	Q2MHE5	3.23e-05	48.5	331	0.115	0.175	DOK6_MOUSE Docking protein 6 OS=Mus musculus OX=10090 GN=Dok6 PE=1 SV=1
6	Q6PKX4	4.36e-05	48.1	331	0.115	0.175	DOK6_HUMAN Docking protein 6 OS=Homo sapiens OX=9606 GN=DOK6 PE=1 SV=1
7	Q99KE3	3.20e-04	45.1	325	0.056	0.086	DOK4_MOUSE Docking protein 4 OS=Mus musculus OX=10090 GN=Dok4 PE=1 SV=1
8	A4IFJ7	3.26e-04	45.1	326	0.056	0.086	A4IFJ7_BOVIN DOK4 protein OS=Bos taurus OX=9913 GN=DOK4 PE=2 SV=1
9	Q8TEW6	3.29e-04	45.1	326	0.056	0.086	DOK4_HUMAN Docking protein 4 OS=Homo sapiens OX=9606 GN=DOK4 PE=1 SV=2
10	Q52RG8	4.67e-04	45.1	492	0.056	0.057	FRS3_RAT Fibroblast growth factor receptor substrate 3 OS=Rattus norvegicus OX=10116 GN=Frs3 PE=2 SV=3
11	O43559	8.00e-04	44.3	492	0.056	0.057	FRS3_HUMAN Fibroblast growth factor receptor substrate 3 OS=Homo sapiens OX=9606 GN=FRS3 PE=1 SV=3
12	Q91ZM9	0.001	43.5	306	0.056	0.092	DOK5_MOUSE Docking protein 5 OS=Mus musculus OX=10090 GN=Dok5 PE=1 SV=1
13	Q9P104	0.001	43.5	306	0.056	0.092	DOK5_HUMAN Docking protein 5 OS=Homo sapiens OX=9606 GN=DOK5 PE=1 SV=2
14	D4A244	0.002	43.1	508	0.052	0.051	D4A244_RAT Fibroblast growth factor receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Frs2 PE=1 SV=1
15	Q8C180	0.002	42.7	508	0.052	0.051	FRS2_MOUSE Fibroblast growth factor receptor substrate 2 OS=Mus musculus OX=10090 GN=Frs2 PE=1 SV=3
16	A0A384NQ31	0.003	42.4	512	0.052	0.051	A0A384NQ31_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
17	Q8WU20	0.003	42.4	508	0.052	0.051	FRS2_HUMAN Fibroblast growth factor receptor substrate 2 OS=Homo sapiens OX=9606 GN=FRS2 PE=1 SV=4
18	E9Q7D5	0.027	39.7	1581	0.071	0.023	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
19	Q9QZK7	0.030	39.3	444	0.046	0.052	DOK3_MOUSE Docking protein 3 OS=Mus musculus OX=10090 GN=Dok3 PE=1 SV=1
20	M9NDM3	0.043	39.3	2169	0.054	0.012	M9NDM3_DROME Rhea, isoform C OS=Drosophila melanogaster OX=7227 GN=rhea PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02174 IRS	0.00022	32.4	PTB domain (IRS-1 type)
2	PF00169 PH	5.4	18.9	PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344432

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363571	0.997	Muscle, skeletal receptor tyrosine-protein kinase
2	9606.ENSP00000300574	0.934	Adapter molecule crk
3	9606.ENSP00000298854	0.913	43 kDa receptor-associated protein of the synapse
4	9606.ENSP00000368678	0.875	Agrin
5	9606.ENSP00000373298	0.875	Acetylcholinesterase collagenic tail peptide
6	9606.ENSP00000258385	0.833	Acetylcholine receptor subunit delta
7	9606.ENSP00000367888	0.814	Low-density lipoprotein receptor-related protein 4
8	9606.ENSP00000293780	0.774	Acetylcholine receptor subunit epsilon
9	9606.ENSP00000262375	0.770	DnaJ homolog subfamily A member 3, mitochondrial
10	9606.ENSP00000303211	0.743	Acetylcholinesterase
11	9606.ENSP00000261007	0.731	Acetylcholine receptor subunit alpha
12	9606.ENSP00000304290	0.727	Acetylcholine receptor subunit beta
13	9606.ENSP00000349860	0.689	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1
14	9606.ENSP00000264381	0.670	Cholinesterase
15	9606.ENSP00000386597	0.667	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
16	9606.ENSP00000374145	0.659	Acetylcholine receptor subunit gamma
17	9606.ENSP00000385026	0.657	Neuronal acetylcholine receptor subunit alpha-2
18	9606.ENSP00000344277	0.647	Docking protein 4
19	9606.ENSP00000396320	0.630	Sodium channel protein type 4 subunit alpha
20	9606.ENSP00000262593	0.625	Docking protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0031323	0.972	regulation of cellular metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0048522	0.964	positive regulation of cellular process
GO:0042325	0.956	regulation of phosphorylation
GO:0009987	0.953	cellular process
GO:0001932	0.953	regulation of protein phosphorylation
GO:0031401	0.951	positive regulation of protein modification process
GO:0050790	0.940	regulation of catalytic activity
GO:0045937	0.933	positive regulation of phosphate metabolic process
GO:0045859	0.933	regulation of protein kinase activity
GO:0050730	0.918	regulation of peptidyl-tyrosine phosphorylation
GO:0001934	0.916	positive regulation of protein phosphorylation
GO:0061097	0.913	regulation of protein tyrosine kinase activity
GO:0051347	0.848	positive regulation of transferase activity
GO:0045860	0.838	positive regulation of protein kinase activity
GO:0050731	0.819	positive regulation of peptidyl-tyrosine phosphorylation
GO:0061098	0.799	positive regulation of protein tyrosine kinase activity
GO:0071840	0.459	cellular component organization or biogenesis
GO:0050896	0.449	response to stimulus
GO:0016043	0.399	cellular component organization
GO:0051716	0.303	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0070013	0.995	intracellular organelle lumen
GO:0005634	0.995	nucleus
GO:0031981	0.991	nuclear lumen
GO:0005654	0.977	nucleoplasm
GO:0005739	0.865	mitochondrion
GO:0071944	0.815	cell periphery
GO:0005886	0.811	plasma membrane
GO:0030054	0.761	cell junction
GO:0012505	0.391	endomembrane system
GO:0031594	0.356	neuromuscular junction
GO:0005829	0.313	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]