StarFunc result for job id Q19T08

User Input

>input (205 residues)
MGTAGAMQLCWVILGFLLFRGHNSQPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEA
NRPSHLSSTGTPGAGVPSSGRDGGTSRDTFQTVPPNSTTMSLSMREDATILPSPTSETVL
TVAAFGVISFIVILVVVVIILVGVVSLRFKCRKSKESEDPQKPGSSGLSESCSTANGEKD
SITLISMKNINMNNGKQSLSAEKVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q19T08	1.000	1.000	5.473E-30	205	1.000	1.000	Q19T08.pdb.gz	ECSCR_HUMAN Endothelial cell-specific chemotaxis regulator OS=Homo sapiens OX=9606 GN=ECSCR PE=1 SV=1
2	AFDB:Q3TZW0	0.419	0.405	3.361E-12	214	0.537	0.514	Q3TZW0.pdb.gz	ECSCR_MOUSE Endothelial cell-specific chemotaxis regulator OS=Mus musculus OX=10090 GN=Ecscr PE=1 SV=2
3	AFDB:P9WI47	0.108	0.056	2.081E-1	556	0.166	0.061	P9WI47.pdb.gz	PPE02_MYCTU PPE family protein PPE2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=PPE2 PE=1 SV=1
4	AFDB:O94714	0.112	0.062	2.820E-1	406	0.171	0.086	O94714.pdb.gz	SPT2_SCHPO Protein spt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt2 PE=3 SV=1
5	AFDB:O60120	0.174	0.160	3.542E-1	230	0.176	0.157	O60120.pdb.gz	YH76_SCHPO Uncharacterized protein C16G5.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16G5.06 PE=3 SV=1
6	AFDB:Q57UN8	0.118	0.029	5.179E-1	1126	0.137	0.025	Q57UN8.pdb.gz	Q57UN8_TRYB2 DNA excision repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.540 PE=4 SV=1
7	AFDB:Q5ALY1	0.170	0.052	8.817E-1	903	0.107	0.024	Q5ALY1.pdb.gz	Q5ALY1_CANAL Esc4p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ESC4 PE=4 SV=1
8	AFDB:Q4VBD9	0.111	0.038	9.513E-1	706	0.137	0.040	Q4VBD9.pdb.gz	GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus OX=10090 GN=Gzf1 PE=1 SV=2
9	AFDB:Q9LVA1	0.116	0.078	9.513E-1	348	0.132	0.078	Q9LVA1.pdb.gz	NC101_ARATH NAC domain-containing protein 101 OS=Arabidopsis thaliana OX=3702 GN=NAC101 PE=2 SV=1
10	AFDB:Q4G017	0.135	0.025	1.107	1502	0.137	0.019	Q4G017.pdb.gz	NISCH_RAT Nischarin OS=Rattus norvegicus OX=10116 GN=Nisch PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q19T08	1.26e-147	410	205	1.000	1.000	ECSCR_HUMAN Endothelial cell-specific chemotaxis regulator OS=Homo sapiens OX=9606 GN=ECSCR PE=1 SV=1
2	Q3TZW0	5.70e-45	150	214	0.600	0.575	ECSCR_MOUSE Endothelial cell-specific chemotaxis regulator OS=Mus musculus OX=10090 GN=Ecscr PE=1 SV=2
3	E7F0W6	1.02e-15	75.1	249	0.205	0.169	E7F0W6_DANRE Cell wall protein DAN4 OS=Danio rerio OX=7955 GN=ecscr PE=4 SV=1
4	Q94269	0.47	33.9	2314	0.161	0.014	Q94269_CAEEL Carboxypeptidase OS=Caenorhabditis elegans OX=6239 GN=ctsa-2 PE=1 SV=2
5	Q2NKG6	1.2	32.3	823	0.156	0.039	Q2NKG6_ECOLX Type IV secretion system protein virB4 OS=Escherichia coli OX=562 GN=trwK PE=3 SV=1
6	O50330	1.4	32.3	823	0.098	0.024	O50330_ECOLX Type IV secretion system protein virB4 OS=Escherichia coli OX=562 GN=trwK PE=1 SV=2
7	P98158	2.2	31.6	4660	0.098	0.004	LRP2_RAT Low-density lipoprotein receptor-related protein 2 OS=Rattus norvegicus OX=10116 GN=Lrp2 PE=1 SV=1
8	Q9Y0A1	3.1	31.2	2892	0.176	0.012	ITPR_CAEEL Inositol 1,4,5-trisphosphate receptor itr-1 OS=Caenorhabditis elegans OX=6239 GN=itr-1 PE=1 SV=1
9	Q9N3T8	4.8	30.4	1186	0.059	0.010	Q9N3T8_CAEEL DNA mismatch repair protein OS=Caenorhabditis elegans OX=6239 GN=msh-6 PE=1 SV=2
10	F1RA39	7.0	30.0	1679	0.093	0.011	MCA2B_DANRE [F-actin]-monooxygenase mical2b OS=Danio rerio OX=7955 GN=mical2b PE=2 SV=3
11	G3V4M0	7.0	30.0	427	0.083	0.040	G3V4M0_HUMAN Presenilin-1 OS=Homo sapiens OX=9606 GN=PSEN1 PE=1 SV=2
12	Q06BH3	9.7	29.6	775	0.122	0.032	SRF1_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 1 OS=Arabidopsis thaliana OX=3702 GN=SRF1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17359 DUF5385	6.6e+02	11.2	Family of unknown function (DUF5385)
2	PF20087 DUF6479	15	17.7	Family of unknown function (DUF6479)
3	PF15820 ECSCR	1.3e-54	193.7	Endothelial cell-specific chemotaxis regulator
4	PF14575 EphA2_TM	1e+02	15.0	Ephrin type-A receptor 2 transmembrane domain
5	PF07219 HemY_N	7.8e+02	11.7	HemY protein N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479243

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344115	0.615	Cadherin-5
2	9606.ENSP00000304945	0.603	Roundabout homolog 4
3	9606.ENSP00000298223	0.601	Folate receptor beta
4	9606.ENSP00000263923	0.564	Vascular endothelial growth factor receptor 2
5	9606.ENSP00000381086	0.560	Deleted in autism-related protein 1
6	9606.ENSP00000310110	0.531	Transmembrane protein 255A
7	9606.ENSP00000392371	0.530	Zinc finger and SCAN domain-containing protein 30
8	9606.ENSP00000317903	0.518	R3H domain containing 2
9	9606.ENSP00000353013	0.518	C-type lectin domain containing 14A
10	9606.ENSP00000387128	0.512	NCK associated protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.987	regulation of cellular process
GO:0051246	0.976	regulation of protein metabolic process
GO:1901342	0.968	regulation of vasculature development
GO:0048519	0.967	negative regulation of biological process
GO:0022603	0.967	regulation of anatomical structure morphogenesis
GO:1904035	0.965	regulation of epithelial cell apoptotic process
GO:0048522	0.964	positive regulation of cellular process
GO:0045765	0.959	regulation of angiogenesis
GO:1901343	0.931	negative regulation of vasculature development
GO:2000351	0.921	regulation of endothelial cell apoptotic process
GO:0016525	0.887	negative regulation of angiogenesis
GO:0009894	0.874	regulation of catabolic process
GO:0051247	0.869	positive regulation of protein metabolic process
GO:1903050	0.834	regulation of proteolysis involved in protein catabolic process
GO:0045862	0.792	positive regulation of proteolysis
GO:0042176	0.783	regulation of protein catabolic process
GO:1904037	0.728	positive regulation of epithelial cell apoptotic process
GO:0009987	0.717	cellular process
GO:0061136	0.716	regulation of proteasomal protein catabolic process
GO:0009896	0.676	positive regulation of catabolic process
GO:0045732	0.661	positive regulation of protein catabolic process
GO:1903052	0.554	positive regulation of proteolysis involved in protein catabolic process
GO:0050896	0.362	response to stimulus
GO:1901800	0.351	positive regulation of proteasomal protein catabolic process
GO:0032501	0.303	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0005634	0.997	nucleus
GO:0070013	0.996	intracellular organelle lumen
GO:0005654	0.975	nucleoplasm
GO:0012505	0.309	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]