StarFunc result for job id Q1HG43

User Input

>input (343 residues)
MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTS
LFIGAAILAVNFSSEWSVGQVSTNTSYKAFSSEWISADIGLQVGLGGVNITLTGTPVQQL
NETINYNEEFTWRLGENYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYT
SAMLWVAFLCWLLANVMLSMPVLVYGGYMLLATGIFQLLALLFFSMATSLTSPCPLHLGA
SVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEG
GLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q1HG43	1.000	1.000	6.138E-56	343	1.000	1.000	Q1HG43.pdb.gz	DOXA1_HUMAN Dual oxidase maturation factor 1 OS=Homo sapiens OX=9606 GN=DUOXA1 PE=1 SV=1
2	AFDB:Q8VE49	0.855	0.860	8.650E-50	341	0.834	0.839	Q8VE49.pdb.gz	DOXA1_MOUSE Dual oxidase maturation factor 1 OS=Mus musculus OX=10090 GN=Duoxa1 PE=1 SV=2
3	PDB:7d3eB	0.791	0.997	1.345E-42	272	0.793	1.000	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.
4	PDB:6wxuB	0.783	0.982	2.366E-38	273	0.691	0.868	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.
5	AFDB:Q9D311	0.822	0.880	1.226E-36	320	0.481	0.516	Q9D311.pdb.gz	DOXA2_MOUSE Dual oxidase maturation factor 2 OS=Mus musculus OX=10090 GN=Duoxa2 PE=2 SV=1
6	AFDB:Q1HG44	0.820	0.877	4.544E-36	320	0.493	0.528	Q1HG44.pdb.gz	DOXA2_HUMAN Dual oxidase maturation factor 2 OS=Homo sapiens OX=9606 GN=DUOXA2 PE=1 SV=2
7	AFDB:Q9VJQ7	0.738	0.540	1.304E-22	474	0.318	0.230	Q9VJQ7.pdb.gz	Q9VJQ7_DROME LD27791p OS=Drosophila melanogaster OX=7227 GN=mol PE=2 SV=2
8	AFDB:P34298	0.696	0.607	2.423E-21	397	0.303	0.262	P34298.pdb.gz	DOXA1_CAEEL Dual oxidase maturation factor 1 OS=Caenorhabditis elegans OX=6239 GN=doxa-1 PE=1 SV=2
9	AFDB:G5EBI8	0.360	0.349	4.201E-8	357	0.122	0.118	G5EBI8.pdb.gz	G5EBI8_CAEEL STarGazin (Mammalian calcium channel) homolog OS=Caenorhabditis elegans OX=6239 GN=stg-2 PE=2 SV=1
10	AFDB:O60359	0.336	0.361	2.577E-7	315	0.105	0.114	O60359.pdb.gz	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
11	AFDB:Q8VHW8	0.286	0.330	5.487E-7	275	0.108	0.135	Q8VHW8.pdb.gz	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
12	AFDB:O88602	0.288	0.302	1.005E-6	323	0.096	0.102	O88602.pdb.gz	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
13	PDB:7rz4A	0.246	0.117	1.523E-4	993	0.090	0.031	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
14	PDB:6ov2A	0.346	0.609	3.410E-4	182	0.085	0.159	6ov2A.pdb.gz
15	PDB:7ocaI	0.296	0.490	3.586E-4	185	0.058	0.108	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
16	PDB:5kbtA	0.313	0.127	8.445E-4	973	0.096	0.034	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
17	PDB:5weoA	0.300	0.127	9.341E-4	988	0.093	0.032	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
18	PDB:5b2gC	0.328	0.322	2.433E-3	350	0.061	0.060	5b2gC.pdb.gz
19	PDB:6wv9A	0.197	0.169	5.260E-2	411	0.070	0.058	6wv9A.pdb.gz
20	PDB:5xqiB	0.225	0.270	7.485E-2	276	0.061	0.076	5xqiB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q1HG43	0.0	706	343	1.000	1.000	DOXA1_HUMAN Dual oxidase maturation factor 1 OS=Homo sapiens OX=9606 GN=DUOXA1 PE=1 SV=1
2	Q8VE49	0.0	575	341	0.834	0.839	DOXA1_MOUSE Dual oxidase maturation factor 1 OS=Mus musculus OX=10090 GN=Duoxa1 PE=1 SV=2
3	Q1HG44	2.45e-114	336	320	0.501	0.537	DOXA2_HUMAN Dual oxidase maturation factor 2 OS=Homo sapiens OX=9606 GN=DUOXA2 PE=1 SV=2
4	Q9D311	2.17e-109	323	320	0.478	0.512	DOXA2_MOUSE Dual oxidase maturation factor 2 OS=Mus musculus OX=10090 GN=Duoxa2 PE=2 SV=1
5	Q9VJQ7	3.85e-44	159	474	0.306	0.222	Q9VJQ7_DROME LD27791p OS=Drosophila melanogaster OX=7227 GN=mol PE=2 SV=2
6	P34298	1.58e-33	129	397	0.289	0.249	DOXA1_CAEEL Dual oxidase maturation factor 1 OS=Caenorhabditis elegans OX=6239 GN=doxa-1 PE=1 SV=2
7	Q7KT87	6.25e-17	82.4	330	0.169	0.176	Q7KT87_DROME Moladietz, isoform G OS=Drosophila melanogaster OX=7227 GN=mol PE=3 SV=2
8	Q14690	9.4	30.8	1871	0.044	0.008	RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10204 DuoxA	8e-109	374.5	Dual oxidase maturation factor
2	PF07332 Phage_holin_3_6	22	16.5	Putative Actinobacterial Holin-X, holin superfamily III

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008960181.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008960182.1	0.895	Dual oxidase 1
2	9597.XP_003809709.1	0.853	Dual oxidase 2
3	9597.XP_008971934.1	0.735	Zinc finger protein 384 isoform X1
4	9597.XP_003806640.1	0.732	Adds the first Dol-P-Man derived mannose in an alpha-1,3 linkage to Man(5)GlcNAc(2)-PP-Dol
5	9597.XP_003823748.1	0.732	Solute carrier family 38 member 7
6	9597.XP_003829870.1	0.732	Family with sequence similarity 214 member B
7	9597.XP_008973276.1	0.732	Belongs to the peptidase S1 family.
8	9597.XP_003805841.1	0.665	NADPH oxidase 3
9	9597.XP_003818574.1	0.649	NADPH oxidase 5
10	9597.XP_003810441.1	0.632	NADPH oxidase 1 isoform X1
11	9597.XP_003807737.2	0.628	Growth factor, augmenter of liver regeneration
12	9597.XP_003808250.1	0.624	ALMS1, centrosome and basal body associated protein
13	9597.XP_003808252.1	0.624	Putative ALMS1-like protein
14	9597.XP_003819773.1	0.618	Integrator complex subunit 1
15	9597.XP_003811574.1	0.617	SAM and SH3 domain-containing protein 1 isoform X1
16	9597.XP_008958527.1	0.616	Homeobox protein EMX1 isoform X1
17	9597.XP_003815441.1	0.606	Cytochrome b-245 heavy chain
18	9597.XP_008975459.1	0.593	ADAM DEC1
19	9597.XP_003817062.1	0.584	NADPH oxidase activator 1
20	9597.XP_008976112.1	0.574	NUMB, endocytic adaptor protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.953	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:2000377	0.991	regulation of reactive oxygen species metabolic process
GO:0009987	0.987	cellular process
GO:0048518	0.986	positive regulation of biological process
GO:0048522	0.973	positive regulation of cellular process
GO:0009893	0.965	positive regulation of metabolic process
GO:0031325	0.955	positive regulation of cellular metabolic process
GO:2000379	0.953	positive regulation of reactive oxygen species metabolic process
GO:0008152	0.949	metabolic process
GO:0044237	0.908	cellular metabolic process
GO:0071704	0.862	organic substance metabolic process
GO:0051179	0.861	localization
GO:0009889	0.437	regulation of biosynthetic process
GO:0072593	0.424	reactive oxygen species metabolic process
GO:0065008	0.405	regulation of biological quality
GO:0044238	0.403	primary metabolic process
GO:0033036	0.396	macromolecule localization
GO:0006807	0.396	nitrogen compound metabolic process
GO:0051641	0.383	cellular localization
GO:1901564	0.343	organonitrogen compound metabolic process
GO:0010310	0.328	regulation of hydrogen peroxide metabolic process
GO:0031328	0.300	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.991	endomembrane system
GO:0005737	0.981	cytoplasm
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0005783	0.608	endoplasmic reticulum
GO:0005829	0.435	cytosol
GO:0031252	0.355	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]