StarFunc result for job id Q1HG44

User Input

>input (320 residues)
MTLWNGVLPFYPQPRHAAGFSVPLLIVILVFLALAASFLLILPGIRGHSRWFWLVRVLLS
LFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARVRLLVGLEGINITLTGTPVHQL
NETIDYNEQFTWRLKENYAAEYANALEKGLPDPVLYLAEKFTPSSPCGLYHQYHLAGHYA
SATLWVAFCFWLLSNVLLSTPAPLYGGLALLTTGAFALFGVFALASISSVPLCPLRLGSS
ALTTQYGAAFWVTLATGVLCLFLGGAVVSLQYVRPSALRTLLDQSAKDCSQERGGSPLIL
GDPLHKQAALPDLKCITTNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q1HG44	1.000	1.000	1.021E-52	320	1.000	1.000	Q1HG44.pdb.gz	DOXA2_HUMAN Dual oxidase maturation factor 2 OS=Homo sapiens OX=9606 GN=DUOXA2 PE=1 SV=2
2	AFDB:Q9D311	0.901	0.901	1.298E-44	320	0.787	0.787	Q9D311.pdb.gz	DOXA2_MOUSE Dual oxidase maturation factor 2 OS=Mus musculus OX=10090 GN=Duoxa2 PE=2 SV=1
3	AFDB:Q1HG43	0.875	0.817	6.296E-37	343	0.534	0.499	Q1HG43.pdb.gz	DOXA1_HUMAN Dual oxidase maturation factor 1 OS=Homo sapiens OX=9606 GN=DUOXA1 PE=1 SV=1
4	AFDB:Q8VE49	0.876	0.822	7.712E-37	341	0.537	0.504	Q8VE49.pdb.gz	DOXA1_MOUSE Dual oxidase maturation factor 1 OS=Mus musculus OX=10090 GN=Duoxa1 PE=1 SV=2
5	PDB:7d3eB	0.829	0.973	1.425E-32	272	0.506	0.596	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.
6	PDB:6wxuB	0.823	0.962	1.367E-30	273	0.497	0.582	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.
7	AFDB:Q9VJQ7	0.785	0.540	2.009E-21	474	0.300	0.203	Q9VJQ7.pdb.gz	Q9VJQ7_DROME LD27791p OS=Drosophila melanogaster OX=7227 GN=mol PE=2 SV=2
8	AFDB:P34298	0.749	0.612	2.313E-18	397	0.275	0.222	P34298.pdb.gz	DOXA1_CAEEL Dual oxidase maturation factor 1 OS=Caenorhabditis elegans OX=6239 GN=doxa-1 PE=1 SV=2
9	AFDB:G5EBI8	0.379	0.349	4.362E-7	357	0.119	0.106	G5EBI8.pdb.gz	G5EBI8_CAEEL STarGazin (Mammalian calcium channel) homolog OS=Caenorhabditis elegans OX=6239 GN=stg-2 PE=2 SV=1
10	AFDB:O60359	0.369	0.374	1.143E-6	315	0.103	0.105	O60359.pdb.gz	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
11	AFDB:O88602	0.345	0.342	3.152E-6	323	0.125	0.124	O88602.pdb.gz	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
12	AFDB:Q8R1W2	0.360	0.356	4.062E-6	324	0.125	0.123	Q8R1W2.pdb.gz	GSG1_MOUSE Germ cell-specific gene 1 protein OS=Mus musculus OX=10090 GN=Gsg1 PE=1 SV=2
13	PDB:7ocaI	0.282	0.419	1.891E-4	185	0.100	0.173	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
14	PDB:7rz4A	0.322	0.134	2.317E-4	993	0.125	0.040	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
15	PDB:5kbtA	0.318	0.125	2.564E-4	973	0.103	0.034	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
16	PDB:6ov2A	0.376	0.622	4.257E-4	182	0.116	0.203	6ov2A.pdb.gz
17	PDB:5weoA	0.290	0.119	8.659E-4	988	0.106	0.034	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
18	PDB:5b2gC	0.386	0.356	1.591E-3	350	0.081	0.074	5b2gC.pdb.gz
19	PDB:5xqiB	0.216	0.241	5.825E-2	276	0.084	0.098	5xqiB.pdb.gz
20	PDB:2zw3A	0.181	0.247	7.135E-2	201	0.031	0.050	2zw3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q1HG44	0.0	642	320	1.000	1.000	DOXA2_HUMAN Dual oxidase maturation factor 2 OS=Homo sapiens OX=9606 GN=DUOXA2 PE=1 SV=2
2	Q9D311	1.87e-180	503	320	0.778	0.778	DOXA2_MOUSE Dual oxidase maturation factor 2 OS=Mus musculus OX=10090 GN=Duoxa2 PE=2 SV=1
3	Q1HG43	2.28e-114	336	343	0.537	0.501	DOXA1_HUMAN Dual oxidase maturation factor 1 OS=Homo sapiens OX=9606 GN=DUOXA1 PE=1 SV=1
4	Q8VE49	1.14e-108	322	341	0.528	0.496	DOXA1_MOUSE Dual oxidase maturation factor 1 OS=Mus musculus OX=10090 GN=Duoxa1 PE=1 SV=2
5	Q9VJQ7	1.08e-33	130	474	0.275	0.186	Q9VJQ7_DROME LD27791p OS=Drosophila melanogaster OX=7227 GN=mol PE=2 SV=2
6	P34298	1.61e-21	95.9	397	0.253	0.204	DOXA1_CAEEL Dual oxidase maturation factor 1 OS=Caenorhabditis elegans OX=6239 GN=doxa-1 PE=1 SV=2
7	Q7KT87	4.89e-11	65.1	330	0.150	0.145	Q7KT87_DROME Moladietz, isoform G OS=Drosophila melanogaster OX=7227 GN=mol PE=3 SV=2
8	Q8IIZ6	0.42	35.0	2194	0.084	0.012	Q8IIZ6_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1041300 PE=4 SV=2
9	A0A8I6AVY6	2.2	32.7	1164	0.081	0.022	A0A8I6AVY6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
10	P70704	2.2	32.7	1164	0.081	0.022	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
11	A0A8I5ZXX6	2.3	32.7	1164	0.081	0.022	A0A8I5ZXX6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
12	A0A8I6G2I8	2.5	32.3	978	0.081	0.027	A0A8I6G2I8_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
13	A0A8I5ZKC1	2.8	32.3	985	0.081	0.026	A0A8I5ZKC1_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
14	F1LUT4	3.0	32.3	984	0.081	0.026	F1LUT4_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=4
15	O70536	9.4	30.4	545	0.056	0.033	SOAT1_RAT Sterol O-acyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Soat1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10204 DuoxA	8.2e-104	358.1	Dual oxidase maturation factor
2	PF15817 TMEM40	4.8e+02	11.9	Transmembrane protein 40 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319705

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000475084	0.999	Dual oxidase 2
2	9606.ENSP00000317997	0.996	Dual oxidase 1
3	9606.ENSP00000222248	0.843	Sodium/iodide cotransporter
4	9606.ENSP00000229447	0.762	Iodotyrosine deiodinase 1
5	9606.ENSP00000362057	0.753	NADPH oxidase 1
6	9606.ENSP00000373518	0.750	NADPH oxidase 5
7	9606.ENSP00000367851	0.730	Cytochrome b-245 heavy chain
8	9606.ENSP00000159060	0.728	NADPH oxidase 3
9	9606.ENSP00000342848	0.697	NADPH oxidase activator 1
10	9606.ENSP00000263317	0.689	NADPH oxidase 4
11	9606.ENSP00000380450	0.683	NADPH oxidase organizer 1
12	9606.ENSP00000265715	0.672	Pendrin
13	9606.ENSP00000318820	0.661	Thyroid peroxidase
14	9606.ENSP00000380019	0.656	Zinc finger protein 384
15	9606.ENSP00000301732	0.650	ATP-binding cassette sub-family A member 3
16	9606.ENSP00000367823	0.650	Protein FAM214B
17	9606.ENSP00000371211	0.650	Transmembrane protease serine 6
18	9606.ENSP00000380793	0.650	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
19	9606.ENSP00000454646	0.650	Putative sodium-coupled neutral amino acid transporter 7
20	9606.ENSP00000482968	0.650	Alstrom syndrome protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0008152	0.996	metabolic process
GO:0009987	0.995	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0019222	0.976	regulation of metabolic process
GO:0071704	0.967	organic substance metabolic process
GO:0031323	0.959	regulation of cellular metabolic process
GO:0048518	0.946	positive regulation of biological process
GO:0051179	0.935	localization
GO:0048522	0.929	positive regulation of cellular process
GO:0006807	0.876	nitrogen compound metabolic process
GO:1901564	0.832	organonitrogen compound metabolic process
GO:0044237	0.783	cellular metabolic process
GO:2000377	0.774	regulation of reactive oxygen species metabolic process
GO:0009893	0.716	positive regulation of metabolic process
GO:0044238	0.622	primary metabolic process
GO:0031325	0.589	positive regulation of cellular metabolic process
GO:0033036	0.578	macromolecule localization
GO:0010310	0.493	regulation of hydrogen peroxide metabolic process
GO:0009889	0.492	regulation of biosynthetic process
GO:0043170	0.484	macromolecule metabolic process
GO:0072593	0.470	reactive oxygen species metabolic process
GO:2000379	0.458	positive regulation of reactive oxygen species metabolic process
GO:0051641	0.431	cellular localization
GO:0070727	0.348	cellular macromolecule localization
GO:0040012	0.325	regulation of locomotion
GO:0065008	0.305	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.966	cytosol
GO:0005783	0.865	endoplasmic reticulum
GO:0031252	0.800	cell leading edge
GO:0045177	0.419	apical part of cell
GO:0070013	0.334	intracellular organelle lumen
GO:0031981	0.320	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]