StarFunc result for job id Q1KMD3

User Input

>input (747 residues)
MEVKRLKVTELRSELQRRGLDSRGLKVDLAQRLQEALDAEMLEDEAGGGGAGPGGACKAE
PRPVAASGGGPGGDEEEDEEEEEEDEEALLEDEDEEPPPAQALGQAAQPPPEPPEAAAME
AAAEPDASEKPAEATAGSGGVNGGEEQGLGKREEDEPEERSGDETPGSEVPGDKAAEEQG
DDQDSEKSKPAGSDGERRGVKRQRDEKDEHGRAYYEFREEAYHSRSKSPLPPEEEAKDEE
EDQTLVNLDTYTSDLHFQVSKDRYGGQPLFSEKFPTLWSGARSTYGVTKGKVCFEAKVTQ
NLPMKEGCTEVSLLRVGWSVDFSRPQLGEDEFSYGFDGRGLKAENGQFEEFGQTFGENDV
IGCFANFETEEVELSFSKNGEDLGVAFWISKDSLADRALLPHVLCKNCVVELNFGQKEEP
FFPPPEEFVFIHAVPVEERVRTAVPPKTIEECEVILMVGLPGSGKTQWALKYAKENPEKR
YNVLGAETVLNQMRMKGLEEPEMDPKSRDLLVQQASQCLSKLVQIASRTKRNFILDQCNV
YNSGQRRKLLLFKTFSRKVVVVVPNEEDWKKRLELRKEVEGDDVPESIMLEMKANFSLPE
KCDYMDEVTYGELEKEEAQPIVTKYKEEARKLLPPSEKRTNRRNNRNKRNRQNRSRGQGY
VGGQRRGYDNRAYGQQYWGQPGNRGGYRNFYDRYRGDYDRFYGRDYEYNRYRDYYRQYNR
DWQSYYYHHPQDRDRYYRNYYGYQGYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q1KMD3	1.000	1.000	0.000	747	1.000	1.000	Q1KMD3.pdb.gz	HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1
2	AFDB:Q9YHD2	0.531	0.524	1.388E-78	757	0.617	0.609	Q9YHD2.pdb.gz	Q9YHD2_CHICK Nuclear calmodulin-binding protein (Fragment) OS=Gallus gallus OX=9031 GN=URP PE=2 SV=1
3	AFDB:Q8VEK3	0.557	0.522	4.092E-65	800	0.424	0.396	Q8VEK3.pdb.gz	HNRPU_MOUSE Heterogeneous nuclear ribonucleoprotein U OS=Mus musculus OX=10090 GN=Hnrnpu PE=1 SV=1
4	AFDB:Q00839	0.537	0.490	8.429E-65	825	0.419	0.379	Q00839.pdb.gz	HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6
5	AFDB:A0A1X7SBS1	0.511	0.513	5.032E-62	744	0.379	0.380	A0A1X7SBS1.pdb.gz	A0A1X7SBS1_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
6	AFDB:E1JGL8	0.497	0.297	4.034E-48	1272	0.340	0.200	E1JGL8.pdb.gz	E1JGL8_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Dmel\CG30122 PE=1 SV=1
7	AFDB:Q9C8J7	0.223	0.321	1.966E-13	509	0.111	0.163	Q9C8J7.pdb.gz	TRO_ARATH Protein TRAUCO OS=Arabidopsis thaliana OX=3702 GN=TRO PE=1 SV=1
8	AFDB:A0A024QZW3	0.200	0.204	2.455E-13	729	0.151	0.155	A0A024QZW3.pdb.gz
9	PDB:7nscA	0.203	0.527	2.214E-11	276	0.060	0.163	7nscA.pdb.gz
10	PDB:7ccbA	0.185	0.763	9.696E-10	164	0.048	0.220	7ccbA.pdb.gz
11	PDB:6swy1	0.193	0.261	1.787E-9	542	0.088	0.122	6swy1.pdb.gz
12	PDB:7tzcA	0.153	0.027	3.482E-9	4404	0.067	0.011	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
13	PDB:7ua3A	0.167	0.029	1.322E-8	4443	0.054	0.009	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
14	PDB:7m6aA	0.172	0.031	3.042E-8	4306	0.070	0.012	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
15	PDB:7nsba	0.180	0.233	3.400E-8	568	0.084	0.111	7nsba.pdb.gz
16	PDB:6wotA	0.152	0.029	3.594E-8	4197	0.062	0.011	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
17	PDB:6wouA	0.141	0.031	1.364E-7	3921	0.058	0.011	6wouA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
18	PDB:7tdgA	0.150	0.029	1.525E-7	4134	0.060	0.011	7tdgA.pdb.gz	Ca 2+ -inactivation of the mammalian ryanodine receptor type 1 in a lipidic environment revealed by cryo-EM.
19	AFDB:A0A1L4AAD6	0.185	0.082	5.838E-5	1780	0.031	0.013	A0A1L4AAD6.pdb.gz	A0A1L4AAD6_DROME Neuralized E3 ubiquitin protein ligase 4 OS=Drosophila melanogaster OX=7227 GN=Neurl4 PE=4 SV=1
20	AFDB:Q86UW6	0.155	0.070	1.692E-2	1770	0.151	0.064	Q86UW6.pdb.gz	N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens OX=9606 GN=N4BP2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q00PI9	0.0	1242	745	0.950	0.953	HNRL2_MOUSE Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Mus musculus OX=10090 GN=Hnrnpul2 PE=1 SV=2
2	Q1KMD3	0.0	1523	747	1.000	1.000	HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1
3	Q9YHD2	0.0	775	757	0.549	0.542	Q9YHD2_CHICK Nuclear calmodulin-binding protein (Fragment) OS=Gallus gallus OX=9031 GN=URP PE=2 SV=1
4	Q5RI18	2.82e-169	502	602	0.348	0.432	Q5RI18_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=9
5	Q8VEK3	6.01e-168	505	800	0.345	0.323	HNRPU_MOUSE Heterogeneous nuclear ribonucleoprotein U OS=Mus musculus OX=10090 GN=Hnrnpu PE=1 SV=1
6	Q6IMY8	1.12e-167	504	798	0.341	0.320	HNRPU_RAT Heterogeneous nuclear ribonucleoprotein U OS=Rattus norvegicus OX=10116 GN=Hnrnpu PE=1 SV=1
7	Q9BUJ2	5.28e-162	491	856	0.382	0.333	HNRL1_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=2
8	A0A1W2PP35	1.98e-161	486	728	0.337	0.346	A0A1W2PP35_HUMAN Heterogeneous nuclear ribonucleoprotein U (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
9	A0A1W2PPH7	1.27e-150	452	549	0.301	0.410	A0A1W2PPH7_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
10	A0A1W2PP34	3.50e-150	451	546	0.301	0.412	A0A1W2PP34_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
11	M0R3F1	4.19e-149	451	641	0.297	0.346	M0R3F1_HUMAN Heterogeneous nuclear ribonucleoprotein U like 1 (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=1
12	A0A1X7SBS1	1.91e-148	453	744	0.299	0.300	A0A1X7SBS1_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
13	B7Z4B8	2.19e-148	454	767	0.297	0.289	B7Z4B8_HUMAN Heterogeneous nuclear ribonucleoprotein U like 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=1
14	A0A0A0MRA5	4.28e-148	453	766	0.297	0.290	A0A0A0MRA5_HUMAN Heterogeneous nuclear ribonucleoprotein U like 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=1
15	A0A1W2PPL4	2.82e-147	443	547	0.299	0.408	A0A1W2PPL4_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
16	Q8VDM6	7.72e-147	452	859	0.296	0.257	HNRL1_MOUSE Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Mus musculus OX=10090 GN=Hnrnpul1 PE=1 SV=1
17	M0QYZ0	6.40e-97	306	371	0.199	0.402	M0QYZ0_HUMAN Heterogeneous nuclear ribonucleoprotein U like 1 (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=1
18	A0A1W2PQD4	9.78e-68	228	327	0.162	0.370	A0A1W2PQD4_HUMAN Heterogeneous nuclear ribonucleoprotein U (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
19	Q86NY3	2.50e-40	160	739	0.115	0.116	Q86NY3_DROME LD24631p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG30122 PE=2 SV=1
20	A8E6M1	1.58e-38	156	1271	0.120	0.071	A8E6M1_DROME GH01011p OS=Drosophila melanogaster OX=7227 GN=CG5477 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13207 AAA_17	83	15.0	AAA domain
2	PF13238 AAA_18	0.87	21.6	AAA domain
3	PF13401 AAA_22	8.1e+02	11.7	AAA domain
4	PF13671 AAA_33	1.3e-17	75.8	AAA domain
5	PF08433 KTI12	15	16.5	Chromatin associated protein KTI12
6	PF02037 SAP	3.9e-05	34.6	SAP domain
7	PF00622 SPRY	5.8e-12	57.2	SPRY domain
8	PF00448 SRP54	2.4e+02	12.7	SRP54-type protein, GTPase domain
9	PF06414 Zeta_toxin	0.065	24.1	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301785

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371230	0.837	GTP:AMP phosphotransferase AK3, mitochondrial
2	9606.ENSP00000327889	0.788	Integrator complex subunit 5
3	9606.ENSP00000328551	0.768	Ras-related protein Rab-28
4	9606.ENSP00000256367	0.735	Tetratricopeptide repeat domain containing
5	9606.ENSP00000382840	0.724	ATP-dependent RNA helicase DDX3X
6	9606.ENSP00000354032	0.692	Seipin
7	9606.ENSP00000375863	0.676	Heterogeneous nuclear ribonucleoprotein U-like protein 1
8	9606.ENSP00000380033	0.658	Probable ATP-dependent RNA helicase DDX17
9	9606.ENSP00000276461	0.655	Erlin-2
10	9606.ENSP00000225792	0.654	Probable ATP-dependent RNA helicase DDX5
11	9606.ENSP00000378286	0.647	Zinc finger and BTB domain-containing protein 3
12	9606.ENSP00000341826	0.616	Heterogeneous nuclear ribonucleoprotein A1
13	9606.ENSP00000354346	0.609	Matrin-3
14	9606.ENSP00000301788	0.593	DNA-directed RNA polymerase II subunit RPB7
15	9606.ENSP00000294179	0.591	Syntaxin-5
16	9606.ENSP00000372067	0.585	Protein arginine N-methyltransferase 8
17	9606.ENSP00000246194	0.561	RNA-binding protein Raly
18	9606.ENSP00000361927	0.544	Heterogeneous nuclear ribonucleoprotein H2
19	9606.ENSP00000365588	0.532	Mediator of DNA damage checkpoint protein 1
20	9606.ENSP00000325376	0.528	Heterogeneous nuclear ribonucleoprotein M

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0019222	0.983	regulation of metabolic process
GO:0071704	0.982	organic substance metabolic process
GO:0043170	0.949	macromolecule metabolic process
GO:0044238	0.947	primary metabolic process
GO:0006807	0.924	nitrogen compound metabolic process
GO:0050794	0.900	regulation of cellular process
GO:0060255	0.898	regulation of macromolecule metabolic process
GO:0050896	0.875	response to stimulus
GO:0044237	0.874	cellular metabolic process
GO:0010468	0.859	regulation of gene expression
GO:0016070	0.855	RNA metabolic process
GO:0048518	0.848	positive regulation of biological process
GO:0009893	0.706	positive regulation of metabolic process
GO:0010604	0.692	positive regulation of macromolecule metabolic process
GO:0051171	0.680	regulation of nitrogen compound metabolic process
GO:0080090	0.673	regulation of primary metabolic process
GO:0031323	0.671	regulation of cellular metabolic process
GO:0048519	0.667	negative regulation of biological process
GO:0048522	0.619	positive regulation of cellular process
GO:0051252	0.617	regulation of RNA metabolic process
GO:0031326	0.582	regulation of cellular biosynthetic process
GO:0048523	0.563	negative regulation of cellular process
GO:0071840	0.528	cellular component organization or biogenesis
GO:0051716	0.512	cellular response to stimulus
GO:0016043	0.492	cellular component organization
GO:0010556	0.478	regulation of macromolecule biosynthetic process
GO:0010467	0.436	gene expression
GO:0006396	0.377	RNA processing
GO:0051179	0.348	localization
GO:0009892	0.335	negative regulation of metabolic process
GO:0006355	0.328	regulation of DNA-templated transcription
GO:0031325	0.314	positive regulation of cellular metabolic process
GO:0051173	0.311	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0016020	0.988	membrane
GO:0032991	0.922	protein-containing complex
GO:0005737	0.791	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]