StarFunc result for job id Q1MSJ5

User Input

>input (1256 residues)
MLFPLQVAAVTSSVRDDPLEHCVSPRTRARSPEICKMADNLDEFIEEQKARLAEDKAELE
SDPPYMEMKGKLSAKLSENSKILISMAKENIPPNSQQTRGSLGIDYGLSLPLGEDYERKK
HKLKEELRQDYRRYLTQGITQGKRKKNFLSTSETDPSTLGVSLPIGERLSAKERLKLERN
KEYNQFLRGKEESSEKFRQVEKSTEPKSQRNKKPIGQVKPDLTSQIQTSCENSEGPRKDV
LTPSEAYEELLNQRRLEEDRYRQLDDEIELRNRRIIKKANEEVGISNLKHQRFASKAGIP
DRRFHRFNEDRVFDRRYHRPDQDPEVSEEMDERFRYESDFDRRLSRVYTNDRMHRNKRGN
MPPMEHDGDVIEQSNIRISSAENKSAPDNETSKSANQDTCSPFAGMLFGGEDRELIQRRK
EKYRLELLEQMAEQQRNKRREKDLELRVAASGAQDPEKSPDRLKQFSVAPRHFEEMIPPE
RPRIAFQTPLPPLSAPSVPPIPSVHPVPSQNEDLRSGLSSALGEMVSPRIAPLPPPPLLP
PLATNYRTPYDDAYYFYGSRNTFDPSLAYYGSGMMGVQPAAYVSAPVTHQLAQPVVNTVG
QNELKITSDQVINSGLIFEDKPKPSKQSLQSYQEALQQQIREREERRKKEREEKEEYEAK
LEAEMRTYNPWGKGGGGAPLRDAKGNLITDLNRMHRQNIDAYHNPDARTYEDKRAVVSLD
PNLATSNAENLEDAANKSSGHMQTQSSPFARGNVFGEPPTELQIKQQELYKNFLRFQIEE
KKQREEAERERLRIAEEKEERRLAEQRARIQQEYEEEQEKKREKEEEQRLKNEEHIRLAE
ERQKEAERKKKEEEEKYNLQLQHYCERDNLIGEETKHMRQPSPIVPALQNKIASKLQRPP
SVDSIIRSFIHESSMSRAQSPPVPARKNQLRAEEEKKNVIMELSEMRKQLRSEERRLQER
LLHMDSDDEIPIRKKERNPMDIFDMARHRLQAPVRRQSPKGLDAATFQNVHDFNELKDRD
SETRVDLKFMYLDPPRDHHTLEIQQQALLREQQKRLNRIKMQEGAKVDLDAIPSAKVREQ
RMPRDDTSDFLKNSLLESDSAFIGAYGETYPAIEDDVLPPPSQLPSARERRRNKWKGLDI
DSSRPNVAPDGLSLKSISSVNVDELRVRNEERMRRLNEFHNKPINTDDESSLVDPDDIMK
HIGDDGSNSVATEPWLRPGTSETLKRFMAEQLNQEQQQIPGKPGTFTWQGLSTAHG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q1MSJ5	1.000	1.000	0.000	1256	1.000	1.000	Q1MSJ5.pdb.gz	CSPP1_HUMAN Centrosome and spindle pole-associated protein 1 OS=Homo sapiens OX=9606 GN=CSPP1 PE=1 SV=4
2	AFDB:Q8I492	0.050	0.045	4.776E-4	1434	0.104	0.091	Q8I492.pdb.gz	Q8I492_PLAF7 Mature parasite-infected erythrocyte surface antigen OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0500800 PE=4 SV=1
3	AFDB:Q07DP5	0.057	0.047	6.561E-3	1715	0.134	0.098	Q07DP5.pdb.gz	Q07DP5_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=2 SV=1
4	AFDB:P13709	0.066	0.045	8.471E-3	2038	0.123	0.076	P13709.pdb.gz	FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster OX=7227 GN=fs(1)h PE=1 SV=2
5	AFDB:A0A0B4JD97	0.036	0.035	1.824E-2	1322	0.119	0.113	A0A0B4JD97.pdb.gz	A0A0B4JD97_DROME Transforming acidic coiled-coil protein, isoform K OS=Drosophila melanogaster OX=7227 GN=tacc PE=1 SV=1
6	AFDB:Q8N3D4	0.038	0.035	3.927E-2	1523	0.110	0.091	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
7	AFDB:Q9H0E9	0.053	0.054	3.927E-2	1235	0.109	0.111	Q9H0E9.pdb.gz	BRD8_HUMAN Bromodomain-containing protein 8 OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=2
8	AFDB:Q9VLL3	0.041	0.064	3.927E-2	753	0.090	0.150	Q9VLL3.pdb.gz	AK200_DROME A-kinase anchor protein 200 OS=Drosophila melanogaster OX=7227 GN=Akap200 PE=1 SV=3
9	AFDB:Q9VQM0	0.064	0.043	7.931E-2	2162	0.146	0.085	Q9VQM0.pdb.gz	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
10	AFDB:Q9FWQ5	0.037	0.030	8.454E-2	1706	0.110	0.081	Q9FWQ5.pdb.gz	HAC12_ARATH Histone acetyltransferase HAC12 OS=Arabidopsis thaliana OX=3702 GN=HAC12 PE=3 SV=2
11	PDB:7d5tRQ	0.035	0.095	3.165	339	0.043	0.159	7d5tRQ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state F1)
12	PDB:7mqaSS	0.027	0.078	3.833	350	0.039	0.140	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7mq9SI	0.027	0.039	4.643	844	0.018	0.026	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7t65A	0.026	0.009	5.277	4252	0.025	0.008	7t65A.pdb.gz	Molecular mechanism of the severe MH/CCD mutation Y522S in skeletal ryanodine receptor (RyR1) by cryo-EM.
15	PDB:2q0oD	0.030	0.315	5.996	87	0.006	0.080	2q0oD.pdb.gz	Structural basis for antiactivation in bacterial quorum sensing.
16	PDB:6lss4	0.029	0.056	6.392	620	0.040	0.081	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
17	PDB:7rroB0	0.036	0.199	6.392	189	0.025	0.169	7rroB0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:5mrcQ	0.020	0.076	8.253	284	0.021	0.095	5mrcQ.pdb.gz	The structure of the yeast mitochondrial ribosome.
19	PDB:6ke6RQ	0.027	0.105	8.798	226	0.017	0.093	6ke6RQ.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
20	PDB:7ajtCL	0.032	0.049	9.378	781	0.018	0.029	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RX88	0.0	1774	1205	0.759	0.791	CSPP1_MOUSE Centrosome and spindle pole associated protein 1 OS=Mus musculus OX=10090 GN=Cspp1 PE=1 SV=2
2	Q1MSJ5	0.0	2568	1256	1.000	1.000	CSPP1_HUMAN Centrosome and spindle pole-associated protein 1 OS=Homo sapiens OX=9606 GN=CSPP1 PE=1 SV=4
3	P33332	0.040	40.8	1336	0.033	0.031	SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC3 PE=1 SV=1
4	Q54P24	0.045	40.4	1215	0.029	0.030	Q54P24_DICDI DH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcC PE=4 SV=1
5	Q9SPL4	0.087	39.7	666	0.021	0.041	AMP22_MACIN Vicilin-like antimicrobial peptides 2-2 OS=Macadamia integrifolia OX=60698 GN=AMP2-2 PE=1 SV=1
6	Q95XZ5	0.27	38.1	2176	0.027	0.016	NIPBL_CAEEL Nipped-B-like protein scc-2 OS=Caenorhabditis elegans OX=6239 GN=scc-2 PE=1 SV=3
7	Q9VMA7	0.34	37.7	1430	0.026	0.023	TGO1_DROME Transport and Golgi organization protein 1 OS=Drosophila melanogaster OX=7227 GN=Tango1 PE=1 SV=2
8	Q9SPL3	0.52	37.0	625	0.021	0.042	AMP23_MACIN Vicilin-like antimicrobial peptides 2-3 (Fragment) OS=Macadamia integrifolia OX=60698 GN=AMP2-3 PE=1 SV=1
9	C9JYB8	1.2	35.8	633	0.023	0.046	C9JYB8_HUMAN Coiled-coil domain containing 66 (Fragment) OS=Homo sapiens OX=9606 GN=CCDC66 PE=1 SV=1
10	A2RUB6	1.7	35.4	948	0.023	0.031	CCD66_HUMAN Coiled-coil domain-containing protein 66 OS=Homo sapiens OX=9606 GN=CCDC66 PE=1 SV=4
11	F4J0L7	1.8	35.4	2156	0.029	0.017	F4J0L7_ARATH Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=At3g50370 PE=1 SV=1
12	Q8RXI0	2.6	34.7	644	0.023	0.045	Q8RXI0_ARATH AAA-type ATPase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g16930 PE=1 SV=1
13	Q95R61	3.9	33.9	310	0.023	0.094	Q95R61_DROME SD04909p OS=Drosophila melanogaster OX=7227 GN=Incenp PE=2 SV=1
14	Q386V6	5.4	33.5	568	0.031	0.069	Q386V6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.46.0004 PE=4 SV=1
15	Q6NS45	6.6	33.5	935	0.021	0.029	CCD66_MOUSE Coiled-coil domain-containing protein 66 OS=Mus musculus OX=10090 GN=Ccdc66 PE=1 SV=3
16	Q9SAF6	6.7	33.5	1128	0.038	0.043	CRWN2_ARATH Protein CROWDED NUCLEI 2 OS=Arabidopsis thaliana OX=3702 GN=CRWN2 PE=1 SV=1
17	Q5TZG5	9.5	32.7	583	0.021	0.046	Q5TZG5_DANRE Ezrin OS=Danio rerio OX=7955 GN=ezr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15236 CCDC66	2.8	19.2	Coiled-coil domain-containing protein 66

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000026756

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000012515	0.777	Dynactin 5 (p25)
2	9593.ENSGGOP00000010868	0.708	RPGRIP1-like
3	9593.ENSGGOP00000011978	0.690	Family with sequence similarity 110, member B
4	9593.ENSGGOP00000012448	0.690	Family with sequence similarity 110, member A
5	9593.ENSGGOP00000016511	0.690	Uncharacterized protein
6	9593.ENSGGOP00000002537	0.684	Outer dense fiber of sperm tails 2-like
7	9593.ENSGGOP00000002385	0.650	Centrosomal protein 41kDa
8	9593.ENSGGOP00000003088	0.647	Meckel syndrome, type 1
9	9593.ENSGGOP00000013177	0.647	Phosphodiesterase 6D, cGMP-specific, rod, delta
10	9593.ENSGGOP00000026190	0.643	Dynactin 2 (p50)
11	9593.ENSGGOP00000022977	0.639	Actin-related protein 10 homolog (S. cerevisiae)
12	9593.ENSGGOP00000004001	0.638	Transmembrane protein 138
13	9593.ENSGGOP00000019197	0.626	KIAA0586
14	9593.ENSGGOP00000011994	0.625	Transmembrane protein 231
15	9593.ENSGGOP00000001187	0.604	Abelson helper integration site 1
16	9593.ENSGGOP00000013114	0.596	Centrosomal protein 104kDa
17	9593.ENSGGOP00000012754	0.591	Dynactin 6
18	9593.ENSGGOP00000023519	0.588	Centrosomal protein 290kDa
19	9593.ENSGGOP00000006317	0.583	OFD1, centriole and centriolar satellite protein
20	9593.ENSGGOP00000014986	0.579	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.984	regulation of cellular process
GO:0048522	0.963	positive regulation of cellular process
GO:0045787	0.786	positive regulation of cell cycle
GO:0010564	0.748	regulation of cell cycle process
GO:0090068	0.707	positive regulation of cell cycle process
GO:0051302	0.696	regulation of cell division
GO:0032465	0.588	regulation of cytokinesis
GO:0051781	0.583	positive regulation of cell division
GO:0032467	0.568	positive regulation of cytokinesis
GO:0009987	0.421	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000922	0.998	spindle pole
GO:0005815	0.997	microtubule organizing center
GO:0005813	0.993	centrosome
GO:0005829	0.938	cytosol
GO:0043227	0.819	membrane-bounded organelle
GO:0034451	0.784	centriolar satellite
GO:0070013	0.330	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]