StarFunc result for job id Q1W6H9

User Input

>input (321 residues)
MRALAALSAPPNERLLPRDPAATRDPDAARPARRSAVERLAADRAKYVRGRPGTGRGVAS
EGSGPGAIKCPGNDPGPPARAPAPVARRAIARKPLRPDSLIIYRQKCEFVRGSGADGPRA
SLVKKLFQGPGKDKAPVPRTGDEGKAGNPETVPTTPGPAADPAIPETPAPAARSAAPSSV
PAAPPGPEPRVVRRRGLQRSQSDLSSRYSAALAESDTFFQYCGLDPEVVEALGRENFTAG
SDCVTLKVRSVSVATSGSGFSRHSGGDDEGLQEEELIEQVPSTTSVIERNARIIKWLYTC
KKAKETPSQEQSRTRGSKPSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q1W6H9	1.000	1.000	5.659E-47	321	1.000	1.000	Q1W6H9.pdb.gz	F110C_HUMAN Protein FAM110C OS=Homo sapiens OX=9606 GN=FAM110C PE=1 SV=2
2	AFDB:A0A024R7V5	0.112	0.098	1.998E-8	370	0.330	0.286	A0A024R7V5.pdb.gz
3	AFDB:A1MAC2	0.096	0.091	1.663E-1	342	0.184	0.173	A1MAC2.pdb.gz
4	AFDB:Q583H0	0.127	0.108	2.816E-1	401	0.159	0.127	Q583H0.pdb.gz	Q583H0_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.30O21.270 PE=4 SV=1
5	AFDB:Q8GYU3	0.114	0.032	3.008E-1	1465	0.153	0.033	Q8GYU3.pdb.gz	IYO_ARATH Transcriptional elongation regulator MINIYO OS=Arabidopsis thaliana OX=3702 GN=IYO PE=1 SV=1
6	AFDB:P78962	0.099	0.091	3.914E-1	355	0.128	0.115	P78962.pdb.gz	ATF21_SCHPO Transcription factor atf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf21 PE=3 SV=1
7	AFDB:Q96AQ6	0.117	0.056	5.094E-1	731	0.168	0.074	Q96AQ6.pdb.gz	PBIP1_HUMAN Pre-B-cell leukemia transcription factor-interacting protein 1 OS=Homo sapiens OX=9606 GN=PBXIP1 PE=1 SV=1
8	AFDB:Q9QWI6	0.104	0.028	7.080E-1	1250	0.165	0.042	Q9QWI6.pdb.gz	SRCN1_MOUSE SRC kinase signaling inhibitor 1 OS=Mus musculus OX=10090 GN=Srcin1 PE=1 SV=2
9	AFDB:Q8N5F7	0.097	0.079	1.199	415	0.128	0.099	Q8N5F7.pdb.gz	NKAP_HUMAN NF-kappa-B-activating protein OS=Homo sapiens OX=9606 GN=NKAP PE=1 SV=1
10	AFDB:Q21148	0.094	0.097	1.461	308	0.150	0.156	Q21148.pdb.gz	ZIP2_CAEEL Transcription factor zip-2 OS=Caenorhabditis elegans OX=6239 GN=zip-2 PE=1 SV=2
11	PDB:6iczM	0.076	0.170	2.646	130	0.062	0.154	6iczM.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
12	PDB:6hivCR	0.074	0.075	7.587	314	0.044	0.045	6hivCR.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
13	PDB:4ob3A	0.075	0.104	9.244	204	0.012	0.020	4ob3A.pdb.gz	The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q1W6H9	0.0	629	321	1.000	1.000	F110C_HUMAN Protein FAM110C OS=Homo sapiens OX=9606 GN=FAM110C PE=1 SV=2
2	Q8TC76	6.52e-27	110	370	0.221	0.192	F110B_HUMAN Protein FAM110B OS=Homo sapiens OX=9606 GN=FAM110B PE=1 SV=1
3	Q8R184	1.43e-22	97.4	296	0.168	0.182	F110A_MOUSE Protein FAM110A OS=Mus musculus OX=10090 GN=Fam110a PE=2 SV=2
4	Q58FA4	4.3	31.6	860	0.065	0.024	E2F8_MOUSE Transcription factor E2F8 OS=Mus musculus OX=10090 GN=E2f8 PE=1 SV=1
5	P59764	8.2	30.8	1978	0.062	0.010	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14160 FAM110_C	1.5e-35	134.1	Centrosome-associated C terminus
2	PF14161 FAM110_N	0.05	25.3	Centrosome-associated N terminus
3	PF03520 KCNQ_channel	4.4e+02	12.0	KCNQ voltage-gated potassium channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328347

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262210	0.920	Centrosome and spindle pole-associated protein 1
2	9606.ENSP00000253083	0.650	Huntingtin-interacting protein 1-related protein
3	9606.ENSP00000384604	0.650	ALK and LTK ligand 2
4	9606.ENSP00000381581	0.604	Plastin-2
5	9606.ENSP00000275954	0.602	Transmembrane protein 47
6	9606.ENSP00000348471	0.600	SH3 domain-containing YSC84-like protein 1
7	9606.ENSP00000451828	0.585	RAC-alpha serine/threonine-protein kinase
8	9606.ENSP00000435637	0.571	Contactin-5
9	9606.ENSP00000296591	0.567	EGF-like repeat and discoidin I-like domain-containing protein 3
10	9606.ENSP00000337797	0.538	P53-induced death domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043014	1.000	alpha-tubulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.987	positive regulation of cellular process
GO:0009966	0.976	regulation of signal transduction
GO:0048584	0.966	positive regulation of response to stimulus
GO:0051128	0.956	regulation of cellular component organization
GO:0040012	0.936	regulation of locomotion
GO:0010647	0.930	positive regulation of cell communication
GO:0009967	0.915	positive regulation of signal transduction
GO:1902531	0.910	regulation of intracellular signal transduction
GO:2000145	0.873	regulation of cell motility
GO:0044087	0.846	regulation of cellular component biogenesis
GO:1902533	0.826	positive regulation of intracellular signal transduction
GO:0051896	0.798	regulation of protein kinase B signaling
GO:0030334	0.787	regulation of cell migration
GO:2000147	0.696	positive regulation of cell motility
GO:0009987	0.619	cellular process
GO:0051897	0.593	positive regulation of protein kinase B signaling
GO:0031344	0.569	regulation of cell projection organization
GO:0060491	0.450	regulation of cell projection assembly
GO:0030335	0.375	positive regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005938	1.000	cell cortex
GO:0043226	0.943	organelle
GO:0043229	0.927	intracellular organelle
GO:0043227	0.917	membrane-bounded organelle
GO:0043231	0.762	intracellular membrane-bounded organelle
GO:0005829	0.748	cytosol
GO:0016020	0.467	membrane
GO:0043232	0.459	intracellular non-membrane-bounded organelle
GO:0005856	0.358	cytoskeleton
GO:0005634	0.328	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]