StarFunc result for job id Q1XH10

User Input

>input (908 residues)
MGDLKSGFEEVDGVRLGYLIIKGKQMFALSQVFTDLLKNIPRTTVHKRMDHLKVKKHHCD
LEELRKLKAINSIAFHAAKCTLISREDVEALYTSCKTERVLKTKRRRVGRALATKAPPPE
RAAAASPRPGFWKDKHQLWRGLSGAARPLPISAQSQRPGAAAARPAAHLPQIFSKYPGSH
YPEIVRSPCKPPLNYETAPLQGNYVAFPSDPAYFRSLLCSKHPAAAAAAAAAAAAAAAAA
AAAAYYQVSAAGPQPKAAAGAGGPGSLSYRCKRKRGGAKDCLLAPHAGARRLLLLPRSYK
AKAAAAAAAAAAAAAAAAGATCLERFHLVNGFCPPPHHHHHHHHHHHHHHHRAQPPQQSH
HPPHHHRPQPHLGSFPESCSSDSESSSYSDHAANDSDFGSSLSSSSNSVSSEEEEEEGEE
EEEEEEEEGGSGASDSSEVSSEEEDSSTESDSSSGSSQVSVQSIRFRRTSFCKPPSVQAQ
ANFLYHLASAAAATKPAAFEDAGRLPDLKSSVKAESPAEWNLQSWAPKASPVYCPASLGS
CFAEIRNDRVSEITFPHSEISNAVKRTDLTINCLAEGASSPSPKTNNAFPQQRILREARK
CLQTTPTTHCADNNTIAARFLNNDSSGAEANSEKYSKILHCPEFATDLPSSQTDPEVNAA
GAAATKAENPCTDTGDKTLPFLHNIKIKVEDSSANEEYEPHLFTNKLKCECNDTKGEFYS
VTESKEEDALLTTAKEGFACPEKETPSLNPLAQSQGLSCTLGSPKPEDGEYKFGARVRKN
YRTLVLGKRPVLQTPPVKPNLKSARSPRPTGKTETNEGTLDDFTVINRRKKVASNVASAV
KRPFHFMANFPCPPSLIIGRDGDLWPAYSLNTTKDSQTPHKAHPIWKWQLGGSAIPLPPS
HKFRKFNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D1YSG4	0.110	0.128	2.300E-7	770	0.135	0.160	D1YSG4.pdb.gz	D1YSG4_DROME CORL OS=Drosophila melanogaster OX=7227 GN=fuss PE=2 SV=1
2	AFDB:Q2VWA4	0.107	0.098	1.123E-6	1001	0.169	0.153	Q2VWA4.pdb.gz	SKOR2_HUMAN SKI family transcriptional corepressor 2 OS=Homo sapiens OX=9606 GN=SKOR2 PE=1 SV=3
3	AFDB:Q9HC77	0.039	0.029	3.478E-2	1338	0.133	0.090	Q9HC77.pdb.gz	CENPJ_HUMAN Centromere protein J OS=Homo sapiens OX=9606 GN=CENPJ PE=1 SV=2
4	AFDB:Q7KHG2	0.040	0.028	5.777E-2	1486	0.156	0.096	Q7KHG2.pdb.gz	JING_DROME Zinc finger protein jing OS=Drosophila melanogaster OX=7227 GN=jing PE=2 SV=1
5	AFDB:X2JEI9	0.044	0.028	1.022E-1	2206	0.146	0.060	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
6	AFDB:A0A024RA49	0.035	0.032	1.404E-1	1124	0.126	0.101	A0A024RA49.pdb.gz
7	AFDB:Q9I7T7	0.038	0.028	2.332E-1	1531	0.149	0.088	Q9I7T7.pdb.gz	LAR4_DROME La-related protein Larp4B OS=Drosophila melanogaster OX=7227 GN=Larp4B PE=1 SV=2
8	AFDB:Q9W468	0.048	0.048	2.821E-1	873	0.131	0.136	Q9W468.pdb.gz	Q9W468_DROME GH28601p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG15765 PE=2 SV=2
9	AFDB:Q1LUB2	0.040	0.035	3.413E-1	1089	0.139	0.116	Q1LUB2.pdb.gz
10	AFDB:Q6NZG4	0.058	0.058	3.875E-1	898	0.123	0.125	Q6NZG4.pdb.gz	DDIAS_MOUSE DNA damage-induced apoptosis suppressor protein OS=Mus musculus OX=10090 GN=Ddias PE=2 SV=1
11	PDB:6lthM	0.072	0.233	6.277E-1	259	0.018	0.062	6lthM.pdb.gz	Structure of nucleosome-bound human BAF complex.
12	PDB:5lclB	0.045	0.183	1.526	114	0.013	0.105	5lclB.pdb.gz	Structural Insights into the Recognition of N(2) -Aryl- and C8-Aryl DNA Lesions by the Repair Protein XPA/Rad14.
13	PDB:6fyxm	0.048	0.189	1.845	147	0.013	0.082	6fyxm.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
14	PDB:1k8kD	0.064	0.151	2.232	284	0.013	0.042	1k8kD.pdb.gz
15	PDB:2effA	0.027	0.172	2.534	106	0.007	0.057	2effA.pdb.gz	Understanding the binding properties of an unusual metal-binding protein - a study of bacterial frataxin
16	PDB:7zu0A	0.031	0.030	2.700	954	0.006	0.005	7zu0A.pdb.gz
17	PDB:7dmeA	0.034	0.061	3.480	308	0.028	0.081	7dmeA.pdb.gz
18	PDB:5hz9A	0.026	0.151	3.708	135	0.004	0.030	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
19	PDB:4azqA	0.026	0.152	3.951	136	0.004	0.029	4azqA.pdb.gz	Crystallographic Study of Fabp5 as an Intracellular Endocannabinoid Transporter.
20	PDB:7ac7U	0.023	0.178	3.951	103	0.004	0.039	7ac7U.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TNS8	1.57e-11	69.3	369	0.037	0.092	EPOP_MOUSE Elongin BC and Polycomb repressive complex 2-associated protein OS=Mus musculus OX=10090 GN=Epop PE=1 SV=1
2	Q925Q8	2.12e-09	63.5	634	0.040	0.057	DACH2_MOUSE Dachshund homolog 2 OS=Mus musculus OX=10090 GN=Dach2 PE=1 SV=1
3	F1R4Z6	9.37e-09	61.6	567	0.033	0.053	F1R4Z6_DANRE Dachshund b OS=Danio rerio OX=7955 GN=zgc:136530 PE=4 SV=1
4	F1R0U6	2.45e-08	60.1	602	0.035	0.053	F1R0U6_DANRE Dachshund a OS=Danio rerio OX=7955 GN=cb907 PE=4 SV=1
5	A1L2G2	1.26e-07	57.8	611	0.029	0.043	A1L2G2_DANRE Dachshund homolog 1 OS=Danio rerio OX=7955 GN=zgc:158869 PE=2 SV=1
6	Q6NR49	4.15e-07	55.5	321	0.031	0.087	Q6NR49_DROME AT14140p OS=Drosophila melanogaster OX=7227 GN=dac PE=2 SV=1
7	Q9UI36	4.36e-07	56.2	758	0.028	0.033	DACH1_HUMAN Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DACH1 PE=1 SV=4
8	Q9QYB2	4.49e-07	56.2	751	0.028	0.033	DACH1_MOUSE Dachshund homolog 1 OS=Mus musculus OX=10090 GN=Dach1 PE=1 SV=1
9	Q24028	7.10e-07	55.8	1074	0.031	0.026	Q24028_DROME Dachshund variant 1 OS=Drosophila melanogaster OX=7227 GN=dac PE=2 SV=1
10	Q8IP20	7.28e-07	55.8	1074	0.031	0.026	Q8IP20_DROME Dachshund, isoform D OS=Drosophila melanogaster OX=7227 GN=dac PE=4 SV=1
11	Q59DY9	7.53e-07	55.8	1072	0.031	0.026	Q59DY9_DROME Dachshund, isoform F OS=Drosophila melanogaster OX=7227 GN=dac PE=4 SV=1
12	Q8IP19	7.67e-07	55.5	1081	0.031	0.026	Q8IP19_DROME Dachshund, isoform B OS=Drosophila melanogaster OX=7227 GN=dac PE=4 SV=1
13	Q24027	8.13e-07	55.5	1072	0.031	0.026	Q24027_DROME Dachshund variant 2 OS=Drosophila melanogaster OX=7227 GN=dac PE=2 SV=1
14	Q24030	8.15e-07	55.5	1081	0.031	0.026	Q24030_DROME Dachshund OS=Drosophila melanogaster OX=7227 GN=dac PE=2 SV=1
15	Q59DZ0	7.08e-06	52.4	1063	0.034	0.029	Q59DZ0_DROME Dachshund, isoform G OS=Drosophila melanogaster OX=7227 GN=dac PE=4 SV=1
16	Q9VJK6	8.92e-06	52.0	1072	0.035	0.030	Q9VJK6_DROME Dachshund, isoform A OS=Drosophila melanogaster OX=7227 GN=dac PE=4 SV=3
17	Q24031	9.31e-06	52.0	1072	0.035	0.030	Q24031_DROME Dachshund variant 3 OS=Drosophila melanogaster OX=7227 GN=dac PE=2 SV=1
18	H2KY91	1.62e-05	50.8	420	0.028	0.060	DAC1_CAEEL Dachshund homolog dac-1 OS=Caenorhabditis elegans OX=6239 GN=dac-1 PE=2 SV=1
19	Q24029	2.29e-05	50.8	1065	0.028	0.023	Q24029_DROME Dachshund variant 4 OS=Drosophila melanogaster OX=7227 GN=dac PE=2 SV=1
20	Q8IP21	2.33e-05	50.8	1065	0.028	0.023	Q8IP21_DROME Dachshund, isoform C OS=Drosophila melanogaster OX=7227 GN=dac PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15223 EPOP	7.6e-179	607.2	Elongin BC and Polycomb repressive complex 2-associated protein
2	PF04147 Nop14	6.4e+02	9.9	Nop14-like family
3	PF02437 Ski_Sno	2.4e-11	54.6	SKI/SNO/DAC family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000410041

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308976	0.730	Von Willebrand factor C domain-containing protein 2-like
2	9606.ENSP00000433427	0.719	ADP-ribosylation factor-like protein 15
3	9606.ENSP00000389427	0.716	Centrosomal protein 44
4	9606.ENSP00000252971	0.687	Motor neuron and pancreas homeobox protein 1
5	9606.ENSP00000378611	0.675	Rho GTPase-activating protein 24
6	9606.ENSP00000258484	0.638	Enhancer of polycomb homolog 2
7	9606.ENSP00000377280	0.568	F-box only protein 8
8	9606.ENSP00000263062	0.553	Enhancer of polycomb homolog 1
9	9606.ENSP00000271526	0.536	Proline-rich protein PRCC
10	9606.ENSP00000433646	0.519	Putative uncharacterized protein C10orf113
11	9606.ENSP00000316578	0.517	Polycomb protein SUZ12
12	9606.ENSP00000354830	0.513	DNA damage-inducible transcript 4-like protein
13	9606.ENSP00000333640	0.508	Eyes absent homolog 2
14	9606.ENSP00000342626	0.508	Eyes absent homolog 1
15	9606.ENSP00000362978	0.508	Eyes absent homolog 3
16	9606.ENSP00000432770	0.508	Eyes absent homolog 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.613	nucleic acid binding
GO:0003677	0.420	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.995	regulation of metabolic process
GO:0050794	0.994	regulation of cellular process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0010468	0.980	regulation of gene expression
GO:0019219	0.978	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.962	regulation of biosynthetic process
GO:0031326	0.900	regulation of cellular biosynthetic process
GO:0010556	0.897	regulation of macromolecule biosynthetic process
GO:0051252	0.880	regulation of RNA metabolic process
GO:0048519	0.853	negative regulation of biological process
GO:0006355	0.821	regulation of DNA-templated transcription
GO:0048523	0.779	negative regulation of cellular process
GO:0009892	0.764	negative regulation of metabolic process
GO:0009987	0.756	cellular process
GO:0051172	0.697	negative regulation of nitrogen compound metabolic process
GO:0010605	0.694	negative regulation of macromolecule metabolic process
GO:0031324	0.693	negative regulation of cellular metabolic process
GO:0045892	0.614	negative regulation of DNA-templated transcription
GO:0032502	0.553	developmental process
GO:0032501	0.542	multicellular organismal process
GO:0048856	0.475	anatomical structure development
GO:0008152	0.407	metabolic process
GO:0071704	0.352	organic substance metabolic process
GO:0044238	0.330	primary metabolic process
GO:0044237	0.328	cellular metabolic process
GO:0006807	0.316	nitrogen compound metabolic process
GO:0043170	0.308	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.582	cytoplasm
GO:0005829	0.308	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]