StarFunc result for job id Q27J81

User Input

>input (1249 residues)
MSVKEGAQRKWAALKEKLGPQDSDPTEANLESADPELCIRLLQMPSVVNYSGLRKRLEGS
DGGWMVQFLEQSGLDLLLEALARLSGRGVARISDALLQLTCVSCVRAVMNSRQGIEYILS
NQGYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSI
VMNELSGSDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLARLRDLEDAD
LLIQLEAFEEAKAEDEEELLRVSGGVDMSSHQEVFASLFHKVSCSPVSAQLLSVLQGLLH
LEPTLRSSQLLWEALESLVNRAVLLASDAQECTLEEVVERLLSVKGRPRPSPLVKAHKSV
QANLDQSQRGSSPQNTTTPKPSVEGQQPAAAAACEPVDHAQSESILKVSQPRALEQQAST
PPPPPPPPLLPGSSAEPPPPPPPPPLPSVGAKALPTAPPPPPLPGLGAMAPPAPPLPPPL
PGSCEFLPPPPPPLPGLGCPPPPPPLLPGMGWGPPPPPPPLLPCTCSPPVAGGMEEVIVA
QVDHGLGSAWVPSHRRVNPPTLRMKKLNWQKLPSNVAREHNSMWASLSSPDAEAVEPDFS
SIERLFSFPAAKPKEPTMVAPRARKEPKEITFLDAKKSLNLNIFLKQFKCSNEEVAAMIR
AGDTTKFDVEVLKQLLKLLPEKHEIENLRAFTEERAKLASADHFYLLLLAIPCYQLRIEC
MLLCEGAAAVLDMVRPKAQLVLAACESLLTSRQLPIFCQLILRIGNFLNYGSHTGDADGF
KISTLLKLTETKSQQNRVTLLHHVLEEAEKSHPDLLQLPRDLEQPSQAAGINLEIIRSEA
SSNLKKLLETERKVSASVAEVQEQYTERLQASISAFRALDELFEAIEQKQRELADYLCED
AQQLSLEDTFSTMKAFRDLFLRALKENKDRKEQAAKAERRKQQLAEEEARRPRGEDGKPV
RKGPGKQEEVCVIDALLADIRKGFQLRKTARGRGDTDGGSKAASMDPPRATEPVATSNPA
GDPVGSTRCPASEPGLDATTASESRGWDLVDAVTPGPQPTLEQLEEGGPRPLERRSSWYV
DASDVLTTEDPQCPQPLEGAWPVTLGDAQALKPLKFSSNQPPAAGSSRQDAKDPTSLLGV
LQAEADSTSEGLEDAVHSRGARPPAAGPGGDEDEDEEDTAPESALDTSLDKSFSEDAVTD
SSGSGTLPRARGRASKGTGKRRKKRPSRSQEEVPPDSDDNKTKKLCVIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q27J81	1.000	1.000	0.000	1249	1.000	1.000	Q27J81.pdb.gz	INF2_HUMAN Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2
2	AFDB:Q0GNC1	0.373	0.366	4.951E-104	1273	0.800	0.785	Q0GNC1.pdb.gz	INF2_MOUSE Inverted formin-2 OS=Mus musculus OX=10090 GN=Inf2 PE=1 SV=1
3	AFDB:Q86T65	0.248	0.287	1.172E-29	1068	0.199	0.232	Q86T65.pdb.gz	DAAM2_HUMAN Disheveled-associated activator of morphogenesis 2 OS=Homo sapiens OX=9606 GN=DAAM2 PE=1 SV=3
4	AFDB:Q96PY5	0.253	0.287	3.185E-25	1086	0.184	0.212	Q96PY5.pdb.gz	FMNL2_HUMAN Formin-like protein 2 OS=Homo sapiens OX=9606 GN=FMNL2 PE=1 SV=3
5	AFDB:Q1ZXK2	0.227	0.261	2.071E-21	1074	0.166	0.193	Q1ZXK2.pdb.gz	FORG_DICDI Formin-G OS=Dictyostelium discoideum OX=44689 GN=forG PE=1 SV=1
6	AFDB:Q9C6S1	0.257	0.260	8.376E-17	1230	0.140	0.142	Q9C6S1.pdb.gz	FH14_ARATH Formin-like protein 14 OS=Arabidopsis thaliana OX=3702 GN=FH14 PE=3 SV=3
7	AFDB:Q6PR54	0.114	0.069	1.619E-2	2419	0.140	0.072	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
8	AFDB:A0A0G2JZW4	0.127	0.079	2.055E-2	2308	0.144	0.078	A0A0G2JZW4.pdb.gz	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
9	PDB:4hm9A	0.141	0.310	2.587E-2	511	0.034	0.082	4hm9A.pdb.gz
10	AFDB:Q9VHC4	0.063	0.068	2.823E-2	1133	0.070	0.078	Q9VHC4.pdb.gz	Q9VHC4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FCHo2 PE=1 SV=3
11	PDB:1wa5B	0.100	0.212	3.156E-2	466	0.035	0.094	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
12	AFDB:A0A2R8QQL1	0.073	0.080	3.880E-2	1108	0.139	0.156	A0A2R8QQL1.pdb.gz
13	PDB:3tpoA	0.126	0.301	6.452E-2	438	0.018	0.050	3tpoA.pdb.gz
14	PDB:6kbnC	0.132	0.288	6.714E-2	504	0.030	0.075	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
15	PDB:3gniA	0.109	0.284	7.269E-2	335	0.029	0.107	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
16	PDB:5tbkA	0.124	0.303	8.189E-2	417	0.026	0.077	5tbkA.pdb.gz
17	PDB:4tnmA	0.115	0.277	1.039E-1	407	0.027	0.084	4tnmA.pdb.gz
18	PDB:4ct7B	0.133	0.516	1.218E-1	269	0.031	0.145	4ct7B.pdb.gz	Structural and Biochemical Insights to the Role of the Ccr4-not Complex and Ddx6 ATPase in Microrna Repression.
19	PDB:4o9yA	0.060	0.037	1.428E-1	2490	0.037	0.018	4o9yA.pdb.gz
20	PDB:6bcuW	0.115	0.133	1.428E-1	1052	0.029	0.034	6bcuW.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0GNC1	0.0	1125	1273	0.457	0.449	INF2_MOUSE Inverted formin-2 OS=Mus musculus OX=10090 GN=Inf2 PE=1 SV=1
2	Q27J81	0.0	2510	1249	1.000	1.000	INF2_HUMAN Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2
3	A8JNM1	1.23e-61	234	1717	0.122	0.089	A8JNM1_DROME Formin 3, isoform B OS=Drosophila melanogaster OX=7227 GN=form3 PE=4 SV=1
4	Q86C16	1.95e-61	233	1644	0.122	0.092	Q86C16_DROME Ah1644 protein OS=Drosophila melanogaster OX=7227 GN=form3 PE=2 SV=1
5	Q3ULZ2	2.11e-54	210	1149	0.098	0.106	FHDC1_MOUSE FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhdc1 PE=1 SV=3
6	Q9C0D6	1.10e-52	204	1143	0.098	0.107	FHDC1_HUMAN FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHDC1 PE=1 SV=2
7	Q80U19	6.93e-51	199	1115	0.168	0.188	DAAM2_MOUSE Disheveled-associated activator of morphogenesis 2 OS=Mus musculus OX=10090 GN=Daam2 PE=1 SV=4
8	Q5RHJ3	4.91e-47	186	1079	0.190	0.220	Q5RHJ3_DANRE Disheveled-associated activator of morphogenesis 1 OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
9	B3DJI0	5.47e-46	183	1069	0.187	0.218	B3DJI0_DANRE Daam1l protein OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
10	A0A1D5P556	9.60e-46	182	1075	0.167	0.194	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2
11	Q86NV5	6.60e-41	167	1167	0.088	0.094	Q86NV5_DROME GH12052p (Fragment) OS=Drosophila melanogaster OX=7227 GN=form3 PE=2 SV=1
12	F1LVW7	7.27e-39	160	1172	0.090	0.096	DIAP3_RAT Protein diaphanous homolog 3 OS=Rattus norvegicus OX=10116 GN=Diaph3 PE=1 SV=4
13	O08808	8.22e-39	160	1255	0.086	0.085	DIAP1_MOUSE Protein diaphanous homolog 1 OS=Mus musculus OX=10090 GN=Diaph1 PE=1 SV=1
14	Q9Z207	2.94e-38	158	1171	0.094	0.100	DIAP3_MOUSE Protein diaphanous homolog 3 OS=Mus musculus OX=10090 GN=Diaph3 PE=1 SV=1
15	Q9NSV4	9.18e-36	150	1193	0.095	0.100	DIAP3_HUMAN Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3 PE=1 SV=4
16	O70566	1.07e-35	150	1098	0.095	0.108	DIAP2_MOUSE Protein diaphanous homolog 2 OS=Mus musculus OX=10090 GN=Diaph2 PE=1 SV=2
17	O60879	5.19e-32	138	1101	0.099	0.113	DIAP2_HUMAN Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2 PE=1 SV=1
18	Q5TJ56	6.56e-32	138	1220	0.099	0.102	FORF_DICDI Formin-F OS=Dictyostelium discoideum OX=44689 GN=forF PE=1 SV=1
19	Q9Y4D1	1.40e-31	136	1078	0.100	0.116	DAAM1_HUMAN Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=2
20	Q9VUC6	2.08e-31	136	1183	0.147	0.155	FRL_DROME Formin-like protein OS=Drosophila melanogaster OX=7227 GN=Frl PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06367 Drf_FH3	1.2e-34	131.2	Diaphanous FH3 Domain
2	PF06371 Drf_GBD	1.4e-13	62.3	Diaphanous GTPase-binding Domain
3	PF02181 FH2	1.1e-70	250.2	Formin Homology 2 Domain
4	PF02205 WH2	0.088	23.9	WH2 motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376410

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.975	Cell division control protein 42 homolog
2	9606.ENSP00000252699	0.875	Alpha-actinin-4
3	9606.ENSP00000352264	0.806	CD2-associated protein
4	9606.ENSP00000356587	0.806	Podocin
5	9606.ENSP00000368190	0.804	Nephrin
6	9606.ENSP00000377001	0.804	Speckle-type POZ protein
7	9606.ENSP00000265748	0.782	Anillin
8	9606.ENSP00000360431	0.764	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
9	9606.ENSP00000387266	0.734	Protein spire homolog 1
10	9606.ENSP00000340913	0.725	Short transient receptor potential channel 6
11	9606.ENSP00000317674	0.720	Apolipoprotein L1
12	9606.ENSP00000288235	0.699	Unconventional myosin-Ie
13	9606.ENSP00000285735	0.695	Rho-related GTP-binding protein RhoC
14	9606.ENSP00000400175	0.685	Transforming protein RhoA
15	9606.ENSP00000378611	0.684	Rho GTPase-activating protein 24
16	9606.ENSP00000367220	0.675	Actin-related protein 2
17	9606.ENSP00000269321	0.660	Rho GDP-dissociation inhibitor 1
18	9606.ENSP00000216181	0.657	Myosin-9
19	9606.ENSP00000268182	0.655	Ras GTPase-activating-like protein IQGAP1
20	9606.ENSP00000479708	0.644	Protein MAL2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.430	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.919	cellular process
GO:0050793	0.915	regulation of developmental process
GO:0022603	0.912	regulation of anatomical structure morphogenesis
GO:0051128	0.896	regulation of cellular component organization
GO:0033043	0.839	regulation of organelle organization
GO:0010821	0.807	regulation of mitochondrion organization
GO:0071840	0.720	cellular component organization or biogenesis
GO:0016043	0.680	cellular component organization
GO:0090140	0.648	regulation of mitochondrial fission
GO:0006996	0.533	organelle organization
GO:0048518	0.373	positive regulation of biological process
GO:0048522	0.360	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.957	cytosol
GO:0043229	0.955	intracellular organelle
GO:0043227	0.926	membrane-bounded organelle
GO:0048471	0.909	perinuclear region of cytoplasm
GO:0016020	0.888	membrane
GO:0043231	0.784	intracellular membrane-bounded organelle
GO:0043232	0.755	intracellular non-membrane-bounded organelle
GO:0005856	0.618	cytoskeleton
GO:0015629	0.459	actin cytoskeleton
GO:0005634	0.340	nucleus
GO:0012505	0.331	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]