StarFunc result for job id Q29980

User Input

>input (383 residues)
MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYD
RQKRRAKPQGQWAENVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCE
IHEDSSTRGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHY
RAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWR
QDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKA
LVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHR
DAAQLGFQPLMSATGSTGSTEGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q29980	1.000	1.000	3.495E-74	383	1.000	1.000	Q29980.pdb.gz	MICB_HUMAN MHC class I polypeptide-related sequence B OS=Homo sapiens OX=9606 GN=MICB PE=1 SV=2
2	AFDB:Q29983	0.746	0.746	3.501E-59	383	0.825	0.825	Q29983.pdb.gz	MICA_HUMAN MHC class I polypeptide-related sequence A OS=Homo sapiens OX=9606 GN=MICA PE=1 SV=1
3	AFDB:A0ZXM3	0.503	0.532	1.631E-28	357	0.264	0.283	A0ZXM3.pdb.gz	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
4	AFDB:U3PTD3	0.495	0.540	2.266E-27	344	0.240	0.267	U3PTD3.pdb.gz	U3PTD3_CHICK MHC class I alpha OS=Gallus gallus OX=9031 PE=2 SV=1
5	AFDB:P01902	0.495	0.510	1.384E-26	368	0.279	0.291	P01902.pdb.gz	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
6	AFDB:Q8HWB0	0.486	0.534	2.529E-26	341	0.248	0.279	Q8HWB0.pdb.gz	HMR1_MOUSE Major histocompatibility complex class I-related gene protein OS=Mus musculus OX=10090 GN=Mr1 PE=1 SV=2
7	AFDB:P01900	0.492	0.511	3.712E-26	365	0.277	0.290	P01900.pdb.gz	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
8	AFDB:P10321	0.499	0.518	3.712E-26	366	0.269	0.281	P10321.pdb.gz	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
9	AFDB:P01901	0.492	0.508	6.080E-26	369	0.282	0.293	P01901.pdb.gz	HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
10	AFDB:P14427	0.488	0.504	6.080E-26	368	0.258	0.269	P14427.pdb.gz	HA14_MOUSE H-2 class I histocompatibility antigen, D-P alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
11	PDB:6d7gA	0.455	0.451	1.297E-23	386	0.219	0.218	6d7gA.pdb.gz
12	PDB:6mp0A	0.486	0.481	6.360E-23	388	0.214	0.211	6mp0A.pdb.gz
13	PDB:6e1iA	0.468	0.462	6.718E-23	389	0.209	0.206	6e1iA.pdb.gz
14	PDB:5j6hA	0.492	0.638	7.919E-23	275	0.222	0.309	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
15	PDB:2qriA	0.503	0.487	4.577E-22	398	0.217	0.209	2qriA.pdb.gz
16	PDB:3nwmA	0.492	0.490	7.097E-22	384	0.219	0.219	3nwmA.pdb.gz
17	PDB:6fgbA	0.486	0.648	3.676E-21	265	0.157	0.226	6fgbA.pdb.gz
18	PDB:3es6A	0.433	0.564	2.245E-20	277	0.201	0.278	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
19	PDB:3ov6A	0.504	0.512	1.163E-18	376	0.141	0.144	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
20	PDB:3s6cA	0.488	0.500	1.229E-16	372	0.120	0.124	3s6cA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q29980	0.0	804	383	1.000	1.000	MICB_HUMAN MHC class I polypeptide-related sequence B OS=Homo sapiens OX=9606 GN=MICB PE=1 SV=2
2	Q29983	0.0	631	383	0.825	0.825	MICA_HUMAN MHC class I polypeptide-related sequence A OS=Homo sapiens OX=9606 GN=MICA PE=1 SV=1
3	Q8HWE5	6.20e-45	160	355	0.258	0.279	MILL2_MOUSE MHC class I-like protein MILL2 OS=Mus musculus OX=10090 GN=Mill2 PE=1 SV=1
4	Q8HWE7	2.20e-43	157	395	0.279	0.271	MILL1_MOUSE MHC class I-like protein MILL1 OS=Mus musculus OX=10090 GN=Mill1 PE=1 SV=1
5	P14427	4.00e-40	147	368	0.243	0.253	HA14_MOUSE H-2 class I histocompatibility antigen, D-P alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
6	P01900	5.62e-40	147	365	0.253	0.266	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
7	F1CN43	1.82e-38	142	344	0.230	0.256	F1CN43_CHICK MHC class I antigen OS=Gallus gallus OX=9031 PE=2 SV=1
8	Q8HWB0	3.12e-38	142	341	0.240	0.270	HMR1_MOUSE Major histocompatibility complex class I-related gene protein OS=Mus musculus OX=10090 GN=Mr1 PE=1 SV=2
9	O46790	1.41e-37	140	355	0.227	0.245	O46790_CHICK MHC class I alpha chain 2 OS=Gallus gallus OX=9031 GN=B-FIV PE=1 SV=1
10	U3PTD3	2.51e-37	139	344	0.217	0.241	U3PTD3_CHICK MHC class I alpha OS=Gallus gallus OX=9031 PE=2 SV=1
11	P01901	3.66e-37	140	369	0.235	0.244	HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
12	Q95601	4.22e-37	139	355	0.225	0.242	Q95601_CHICK MHC class I alpha chain 2 OS=Gallus gallus OX=9031 GN=BFIV21 PE=1 SV=1
13	A0A583ZBW8	5.60e-37	139	366	0.238	0.249	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
14	Q9JHM2	8.10e-37	139	369	0.225	0.233	Q9JHM2_RAT MHC class I protein OS=Rattus norvegicus OX=10116 GN=RT1-A3 PE=2 SV=1
15	F8W7W8	8.67e-37	138	337	0.240	0.273	F8W7W8_HUMAN Homeostatic iron regulator OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
16	A0ZXM3	1.05e-36	138	357	0.230	0.246	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
17	A0A8J8XB15	1.38e-36	137	342	0.227	0.254	A0A8J8XB15_RAT RT1 class I, locus CE14 OS=Rattus norvegicus OX=10116 GN=RT1-CE14 PE=3 SV=1
18	Q30201	1.62e-36	137	348	0.240	0.264	HFE_HUMAN Hereditary hemochromatosis protein OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
19	P70387	2.11e-36	137	359	0.274	0.292	HFE_MOUSE Hereditary hemochromatosis protein homolog OS=Mus musculus OX=10090 GN=Hfe PE=1 SV=2
20	Q4KN81	2.36e-36	137	360	0.238	0.253	Q4KN81_MOUSE Histocompatibility 2, Q region locus 2 OS=Mus musculus OX=10090 GN=H2-Q2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	4.3e-07	41.5	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	19	16.7	CD80-like C2-set immunoglobulin domain
3	PF13895 Ig_2	1.5e+02	14.1	Immunoglobulin domain
4	PF13927 Ig_3	0.22	23.4	Immunoglobulin domain
5	PF00129 MHC_I	3.9e-22	90.2	Class I Histocompatibility antigen, domains alpha 1 and 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252229

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240618	0.999	Killer cell lectin-like receptor subfamily K, member 1
2	9606.ENSP00000480609	0.994	annotation not available
3	9606.ENSP00000452780	0.907	Beta-2-microglobulin
4	9606.ENSP00000229708	0.873	UL16-binding protein 1
5	9606.ENSP00000356320	0.870	UL16-binding protein 2
6	9606.ENSP00000246551	0.866	Hematopoietic cell signal transducer
7	9606.ENSP00000413079	0.807	MHC class I polypeptide-related sequence A
8	9606.ENSP00000356329	0.739	UL-16 binding protein 5
9	9606.ENSP00000356310	0.717	UL16-binding protein 6
10	9606.ENSP00000371333	0.687	Natural killer cells antigen CD94
11	9606.ENSP00000342156	0.684	Natural cytotoxicity triggering receptor 3
12	9606.ENSP00000280200	0.681	CD226 antigen
13	9606.ENSP00000438038	0.681	NKG2-A/NKG2-B type II integral membrane protein
14	9606.ENSP00000252483	0.666	Nectin-2
15	9606.ENSP00000291890	0.656	Natural cytotoxicity triggering receptor 1
16	9606.ENSP00000362181	0.654	Natural cytotoxicity triggering receptor 2
17	9606.ENSP00000402060	0.652	Poliovirus receptor
18	9606.ENSP00000291860	0.630	Killer cell immunoglobulin-like receptor 3DL3
19	9606.ENSP00000365174	0.630	Diphosphoinositol polyphosphate phosphohydrolase 3-alpha
20	9606.ENSP00000371327	0.629	NKG2-C type II integral membrane protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046703	1.000	natural killer cell lectin-like receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048583	0.996	regulation of response to stimulus
GO:0050896	0.995	response to stimulus
GO:0009987	0.991	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0002682	0.982	regulation of immune system process
GO:0002376	0.981	immune system process
GO:0050778	0.970	positive regulation of immune response
GO:0051716	0.960	cellular response to stimulus
GO:0080134	0.947	regulation of response to stress
GO:0001775	0.945	cell activation
GO:0031347	0.938	regulation of defense response
GO:0046649	0.928	lymphocyte activation
GO:0006950	0.927	response to stress
GO:0002831	0.925	regulation of response to biotic stimulus
GO:0032101	0.908	regulation of response to external stimulus
GO:0048519	0.893	negative regulation of biological process
GO:0032102	0.874	negative regulation of response to external stimulus
GO:0045088	0.874	regulation of innate immune response
GO:0002703	0.870	regulation of leukocyte mediated immunity
GO:0042110	0.851	T cell activation
GO:0031348	0.790	negative regulation of defense response
GO:0002832	0.786	negative regulation of response to biotic stimulus
GO:0009607	0.767	response to biotic stimulus
GO:0002706	0.745	regulation of lymphocyte mediated immunity
GO:0031341	0.743	regulation of cell killing
GO:0023052	0.741	signaling
GO:0007154	0.735	cell communication
GO:0007165	0.701	signal transduction
GO:0001910	0.695	regulation of leukocyte mediated cytotoxicity
GO:0009605	0.682	response to external stimulus
GO:0048522	0.634	positive regulation of cellular process
GO:0006955	0.626	immune response
GO:0048523	0.597	negative regulation of cellular process
GO:0044419	0.589	biological process involved in interspecies interaction between organisms
GO:0002252	0.517	immune effector process
GO:0006952	0.497	defense response
GO:0051707	0.467	response to other organism
GO:0051239	0.464	regulation of multicellular organismal process
GO:0002683	0.450	negative regulation of immune system process
GO:0002715	0.446	regulation of natural killer cell mediated immunity
GO:0007166	0.442	cell surface receptor signaling pathway
GO:0042269	0.418	regulation of natural killer cell mediated cytotoxicity
GO:0002699	0.404	positive regulation of immune effector process
GO:0051249	0.402	regulation of lymphocyte activation
GO:0019222	0.397	regulation of metabolic process
GO:0060255	0.384	regulation of macromolecule metabolic process
GO:0010468	0.373	regulation of gene expression
GO:0045087	0.307	innate immune response
GO:0002443	0.305	leukocyte mediated immunity
GO:0002449	0.304	lymphocyte mediated immunity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0009986	0.823	cell surface
GO:0005576	0.614	extracellular region
GO:0005615	0.579	extracellular space
GO:0005622	0.520	intracellular anatomical structure
GO:0009897	0.318	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]