StarFunc result for job id Q29983

User Input

>input (383 residues)
MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCD
RQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCE
IHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHY
HAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWR
QDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKV
LVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHR
DATQLGFQPLMSDLGSTGSTEGA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q29983	1.000	1.000	3.315E-72	383	1.000	1.000	Q29983.pdb.gz	MICA_HUMAN MHC class I polypeptide-related sequence A OS=Homo sapiens OX=9606 GN=MICA PE=1 SV=1
2	AFDB:Q29980	0.746	0.746	1.260E-57	383	0.825	0.825	Q29980.pdb.gz	MICB_HUMAN MHC class I polypeptide-related sequence B OS=Homo sapiens OX=9606 GN=MICB PE=1 SV=2
3	AFDB:A0ZXM3	0.503	0.532	1.921E-28	357	0.261	0.280	A0ZXM3.pdb.gz	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
4	AFDB:P01902	0.505	0.519	1.854E-27	368	0.261	0.272	P01902.pdb.gz	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
5	AFDB:U3PTD3	0.489	0.532	3.357E-27	344	0.245	0.273	U3PTD3.pdb.gz	U3PTD3_CHICK MHC class I alpha OS=Gallus gallus OX=9031 PE=2 SV=1
6	AFDB:P01901	0.480	0.494	6.771E-27	369	0.272	0.282	P01901.pdb.gz	HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
7	AFDB:P10321	0.522	0.540	7.147E-27	366	0.261	0.273	P10321.pdb.gz	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
8	AFDB:P01900	0.474	0.493	8.869E-27	365	0.266	0.279	P01900.pdb.gz	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
9	AFDB:P01897	0.478	0.498	2.343E-26	362	0.264	0.279	P01897.pdb.gz	HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain OS=Mus musculus OX=10090 GN=H2-L PE=1 SV=2
10	AFDB:A0A0G2K4S5	0.491	0.503	2.473E-26	372	0.266	0.274	A0A0G2K4S5.pdb.gz	A0A0G2K4S5_RAT RT1 class Ia, locus A2 OS=Rattus norvegicus OX=10116 GN=RT1-CE1 PE=3 SV=2
11	PDB:5j6hA	0.474	0.610	6.756E-23	275	0.222	0.309	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
12	PDB:6mp0A	0.463	0.458	7.527E-23	388	0.227	0.224	6mp0A.pdb.gz
13	PDB:6d7gA	0.435	0.433	2.256E-21	386	0.214	0.212	6d7gA.pdb.gz
14	PDB:6e1iA	0.460	0.455	3.292E-21	389	0.211	0.208	6e1iA.pdb.gz
15	PDB:3nwmA	0.469	0.468	3.870E-21	384	0.219	0.219	3nwmA.pdb.gz
16	PDB:2qriA	0.479	0.465	4.803E-21	398	0.232	0.224	2qriA.pdb.gz
17	PDB:6fgbA	0.448	0.598	1.786E-19	265	0.151	0.219	6fgbA.pdb.gz
18	PDB:3es6A	0.427	0.550	5.258E-19	277	0.193	0.267	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
19	PDB:3ov6A	0.485	0.492	2.219E-16	376	0.146	0.149	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
20	PDB:1cd1A	0.458	0.594	6.530E-16	273	0.117	0.165	1cd1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q29980	0.0	619	383	0.825	0.825	MICB_HUMAN MHC class I polypeptide-related sequence B OS=Homo sapiens OX=9606 GN=MICB PE=1 SV=2
2	Q29983	0.0	805	383	1.000	1.000	MICA_HUMAN MHC class I polypeptide-related sequence A OS=Homo sapiens OX=9606 GN=MICA PE=1 SV=1
3	Q8HWE5	7.81e-42	152	355	0.256	0.276	MILL2_MOUSE MHC class I-like protein MILL2 OS=Mus musculus OX=10090 GN=Mill2 PE=1 SV=1
4	P01900	1.41e-40	149	365	0.243	0.255	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
5	P01901	1.42e-39	146	369	0.277	0.287	HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
6	P14427	4.00e-39	145	368	0.240	0.250	HA14_MOUSE H-2 class I histocompatibility antigen, D-P alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
7	P14430	8.95e-39	143	326	0.261	0.307	HA18_MOUSE H-2 class I histocompatibility antigen, Q8 alpha chain OS=Mus musculus OX=10090 GN=H2-Q8 PE=3 SV=1
8	Q4KN81	6.83e-38	141	360	0.238	0.253	Q4KN81_MOUSE Histocompatibility 2, Q region locus 2 OS=Mus musculus OX=10090 GN=H2-Q2 PE=1 SV=1
9	Q8HWB0	7.15e-38	141	341	0.240	0.270	HMR1_MOUSE Major histocompatibility complex class I-related gene protein OS=Mus musculus OX=10090 GN=Mr1 PE=1 SV=2
10	Q95476	1.05e-37	141	355	0.238	0.256	Q95476_BOVIN MHC Class I (Fragment) OS=Bos taurus OX=9913 GN=JSP.1 PE=2 SV=1
11	A0A2P1NRY1	1.77e-37	140	352	0.225	0.244	A0A2P1NRY1_RAT RT1 class I, CE11 OS=Rattus norvegicus OX=10116 GN=RT1-A1 PE=1 SV=1
12	E9PX63	1.12e-36	138	341	0.256	0.287	E9PX63_MOUSE Histocompatibility 2, Q region locus 1 OS=Mus musculus OX=10090 GN=H2-Q1 PE=1 SV=1
13	O19441	1.47e-36	138	368	0.256	0.266	O19441_MOUSE Histocompatibility 2, Q region locus 1 OS=Mus musculus OX=10090 GN=H2-Q1 PE=1 SV=1
14	Q5RIP0	2.35e-36	137	366	0.240	0.251	Q5RIP0_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
15	Q8HWE7	2.58e-36	138	395	0.253	0.246	MILL1_MOUSE MHC class I-like protein MILL1 OS=Mus musculus OX=10090 GN=Mill1 PE=1 SV=1
16	P04439	2.92e-36	137	365	0.230	0.241	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
17	P01898	3.47e-36	136	325	0.232	0.274	HA10_MOUSE H-2 class I histocompatibility antigen, Q10 alpha chain OS=Mus musculus OX=10090 GN=H2-Q10 PE=1 SV=3
18	P14426	4.11e-36	137	362	0.258	0.273	HA13_MOUSE H-2 class I histocompatibility antigen, D-K alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
19	P01893	4.37e-36	137	362	0.222	0.235	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
20	A0A0G2K4S5	5.23e-36	136	356	0.285	0.306	A0A0G2K4S5_RAT RT1 class Ia, locus A2 OS=Rattus norvegicus OX=10116 GN=RT1-CE1 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	6e-07	41.1	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	4.5e+02	12.3	CD80-like C2-set immunoglobulin domain
3	PF13927 Ig_3	4.6	19.2	Immunoglobulin domain
4	PF00129 MHC_I	8e-21	85.9	Class I Histocompatibility antigen, domains alpha 1 and 2
5	PF03347 TDH	2.7e+02	12.5	Vibrio thermostable direct hemolysin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000027668

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000006799	0.945	Killer cell lectin like receptor K1
2	9593.ENSGGOP00000018204	0.876	Beta-2-microglobulin
3	9593.ENSGGOP00000004404	0.761	C-type lectin domain family 7, member A
4	9593.ENSGGOP00000010258	0.760	Killer cell lectin-like receptor subfamily D, member 1
5	9593.ENSGGOP00000007539	0.722	UL16 binding protein 1
6	9593.ENSGGOP00000002242	0.652	Protein disulfide isomerase family A, member 6
7	9593.ENSGGOP00000010272	0.649	CD99 molecule (Xg blood group)
8	9593.ENSGGOP00000014956	0.637	Hematopoietic cell signal transducer
9	9593.ENSGGOP00000003811	0.631	Uncharacterized protein
10	9593.ENSGGOP00000021597	0.575	Killer cell lectin-like receptor subfamily C, member 1
11	9593.ENSGGOP00000005917	0.524	CD226 molecule
12	9593.ENSGGOP00000015859	0.523	Ubiquilin 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046703	0.999	natural killer cell lectin-like receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050789	0.996	regulation of biological process
GO:0009987	0.989	cellular process
GO:0048583	0.988	regulation of response to stimulus
GO:0002682	0.986	regulation of immune system process
GO:0050794	0.985	regulation of cellular process
GO:0002376	0.983	immune system process
GO:0050776	0.952	regulation of immune response
GO:0001775	0.943	cell activation
GO:0031347	0.938	regulation of defense response
GO:0002831	0.935	regulation of response to biotic stimulus
GO:0006955	0.927	immune response
GO:0048518	0.901	positive regulation of biological process
GO:0032101	0.901	regulation of response to external stimulus
GO:0046649	0.891	lymphocyte activation
GO:0001910	0.889	regulation of leukocyte mediated cytotoxicity
GO:0050778	0.885	positive regulation of immune response
GO:0002706	0.884	regulation of lymphocyte mediated immunity
GO:0048519	0.868	negative regulation of biological process
GO:0006950	0.866	response to stress
GO:0045088	0.865	regulation of innate immune response
GO:0002252	0.843	immune effector process
GO:0048523	0.840	negative regulation of cellular process
GO:0051716	0.830	cellular response to stimulus
GO:0048585	0.819	negative regulation of response to stimulus
GO:0042110	0.809	T cell activation
GO:0032102	0.794	negative regulation of response to external stimulus
GO:0002715	0.782	regulation of natural killer cell mediated immunity
GO:0042269	0.772	regulation of natural killer cell mediated cytotoxicity
GO:0002683	0.766	negative regulation of immune system process
GO:0002443	0.764	leukocyte mediated immunity
GO:0006952	0.763	defense response
GO:0031348	0.742	negative regulation of defense response
GO:0002832	0.741	negative regulation of response to biotic stimulus
GO:0051239	0.727	regulation of multicellular organismal process
GO:0009605	0.684	response to external stimulus
GO:0002694	0.665	regulation of leukocyte activation
GO:0009607	0.652	response to biotic stimulus
GO:0044419	0.637	biological process involved in interspecies interaction between organisms
GO:0098542	0.618	defense response to other organism
GO:0001906	0.559	cell killing
GO:0002449	0.556	lymphocyte mediated immunity
GO:0007154	0.515	cell communication
GO:0023052	0.499	signaling
GO:0007165	0.492	signal transduction
GO:0048522	0.484	positive regulation of cellular process
GO:0019222	0.394	regulation of metabolic process
GO:0007166	0.389	cell surface receptor signaling pathway
GO:0060255	0.380	regulation of macromolecule metabolic process
GO:0051249	0.360	regulation of lymphocyte activation
GO:0001909	0.315	leukocyte mediated cytotoxicity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005576	0.846	extracellular region
GO:0009986	0.792	cell surface
GO:0005615	0.484	extracellular space
GO:0009897	0.423	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]