StarFunc result for job id Q29RF7

User Input

>input (1337 residues)
MDFTAQPKPATALCGVVSADGKIAYPPGVKEITDKITTDEMIKRLKMVVKTFMDMDQDSE
DEKQQYLPLALHLASEFFLRNPNKDVRLLVACCLADIFRIYAPEAPYTSHDKLKDIFLFI
TRQLKGLEDTKSPQFNRYFYLLENLAWVKSYNICFELEDCNEIFIQLFRTLFSVINNSHN
KKVQMHMLDLMSSIIMEGDGVTQELLDSILINLIPAHKNLNKQSFDLAKVLLKRTVQTIE
ACIANFFNQVLVLGRSSVSDLSEHVFDLIQELFAIDPHLLLSVMPQLEFKLKSNDGEERL
AVVRLLAKLFGSKDSDLATQNRPLWQCFLGRFNDIHVPVRLESVKFASHCLMNHPDLAKD
LTEYLKVRSHDPEEAIRHDVIVTIITAAKRDLALVNDQLLGFVRERTLDKRWRVRKEAMM
GLAQLYKKYCLHGEAGKEAAEKVSWIKDKLLHIYYQNSIDDKLLVEKIFAQYLVPHNLET
EERMKCLYYLYASLDPNAVKALNEMWKCQNMLRSHVRELLDLHKQPTSEANCSAMFGKLM
TIAKNLPDPGKAQDFVKKFNQVLGDDEKLRSQLELLISPTCSCKQADICVREIARKLANP
KQPTNPFLEMVKFLLERIAPVHIDSEAISALVKLMNKSIEGTADDEEEGVSPDTAIRSGL
ELLKVLSFTHPTSFHSAETYESLLQCLRMEDDKVAEAAIQIFRNTGHKIETDLPQIRSTL
IPILHQKAKRGTPHQAKQAVHCIHAIFTNKEVQLAQIFEPLSRSLNADVPEQLITPLVSL
GHISMLAPDQFASPMKSVVANFIVKDLLMNDRSTGEKNGKLWSPDEEVSPEVLAKVQAIK
LLVRWLLGMKNNQSKSANSTLRLLSAMLVSEGDLTEQKRISKSDMSRLRLAAGSAIMKLA
QEPCYHEIITPEQFQLCALVINDECYQVRQIFAQKLHKALVKLLLPLEYMAIFALCAKDP
VKERRAHARQCLLKNISIRREYIKQNPMATEKLLSLLPEYVVPYMIHLLAHDPDFTRSQD
VDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCD
VALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGV
LGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEEN
PVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDES
GPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQ
DLAKKAAPAERQIDLQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q29RF7	1.000	1.000	0.000	1337	1.000	1.000	Q29RF7.pdb.gz	PDS5A_HUMAN Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1
2	AFDB:Q498H0	0.819	0.757	0.000	1448	0.681	0.628	Q498H0.pdb.gz	PD5BA_XENLA Sister chromatid cohesion protein PDS5 homolog B-A OS=Xenopus laevis OX=8355 GN=pds5b-a PE=1 SV=1
3	AFDB:Q4QXM3	0.887	0.896	0.000	1323	0.864	0.873	Q4QXM3.pdb.gz	PD5AA_XENLA Sister chromatid cohesion protein PDS5 homolog A-A OS=Xenopus laevis OX=8355 GN=pds5a-a PE=1 SV=1
4	AFDB:Q6TRW4	0.819	0.758	0.000	1447	0.680	0.628	Q6TRW4.pdb.gz	PDS5B_RAT Sister chromatid cohesion protein PDS5 homolog B OS=Rattus norvegicus OX=10116 GN=Pds5b PE=1 SV=2
5	AFDB:A1Z8S6	0.754	0.823	8.546E-65	1218	0.325	0.357	A1Z8S6.pdb.gz	A1Z8S6_DROME Precocious dissociation of sisters 5, isoform A OS=Drosophila melanogaster OX=7227 GN=pds5 PE=1 SV=1
6	PDB:7qenD	0.294	0.359	3.536E-10	1050	0.105	0.133	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
7	PDB:7q2xD	0.293	0.375	9.471E-10	994	0.105	0.141	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
8	AFDB:Q6PR54	0.157	0.106	9.655E-10	2419	0.117	0.065	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
9	PDB:6xu2A	0.172	0.201	7.819E-9	1091	0.096	0.118	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
10	AFDB:Q5UIP0	0.132	0.085	1.351E-8	2472	0.113	0.061	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
11	PDB:4jlqA	0.149	0.219	3.677E-8	840	0.092	0.146	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
12	PDB:1qgkA	0.165	0.222	4.233E-8	876	0.091	0.139	1qgkA.pdb.gz
13	PDB:4a0cA	0.195	0.216	5.415E-8	1155	0.111	0.129	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
14	PDB:6zz6D	0.243	0.289	8.861E-8	1050	0.108	0.138	6zz6D.pdb.gz	Transport of DNA within cohesin involves clamping on top of engaged heads by Scc2 and entrapment within the ring by Scc3.
15	PDB:6qnxA	0.253	0.334	9.507E-8	928	0.098	0.141	6qnxA.pdb.gz	The structural basis for cohesin-CTCF-anchored loops.
16	PDB:6x9oA	0.147	0.101	1.260E-7	2425	0.127	0.070	6x9oA.pdb.gz
17	PDB:7mqaSP	0.172	0.119	1.305E-7	2485	0.132	0.071	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	AFDB:A0A0B4K7Q6	0.116	0.093	4.182E-6	2008	0.128	0.085	A0A0B4K7Q6.pdb.gz	A0A0B4K7Q6_DROME Myoblast city, isoform B OS=Drosophila melanogaster OX=7227 GN=mbc PE=3 SV=1
19	AFDB:Q55BD8	0.115	0.163	8.451E-6	899	0.088	0.130	Q55BD8.pdb.gz	Q55BD8_DICDI CLIP-associating protein OS=Dictyostelium discoideum OX=44689 GN=clasp PE=4 SV=1
20	AFDB:Q8IZD9	0.120	0.098	2.110E-5	2030	0.128	0.084	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1Z8S6	0.0	750	1218	0.328	0.360	A1Z8S6_DROME Precocious dissociation of sisters 5, isoform A OS=Drosophila melanogaster OX=7227 GN=pds5 PE=1 SV=1
2	G1UI16	0.0	2767	1337	1.000	1.000	G1UI16_HUMAN SCC-112 protein, isoform CRA_b OS=Homo sapiens OX=9606 GN=PDS5A PE=2 SV=1
3	Q29RF7	0.0	2767	1337	1.000	1.000	PDS5A_HUMAN Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1
4	Q498H0	0.0	1883	1448	0.681	0.629	PD5BA_XENLA Sister chromatid cohesion protein PDS5 homolog B-A OS=Xenopus laevis OX=8355 GN=pds5b-a PE=1 SV=1
5	Q4QXM3	0.0	2390	1323	0.868	0.877	PD5AA_XENLA Sister chromatid cohesion protein PDS5 homolog A-A OS=Xenopus laevis OX=8355 GN=pds5a-a PE=1 SV=1
6	Q4VA53	0.0	1898	1446	0.687	0.635	PDS5B_MOUSE Sister chromatid cohesion protein PDS5 homolog B OS=Mus musculus OX=10090 GN=Pds5b PE=1 SV=1
7	Q6A026	0.0	2692	1332	0.976	0.980	PDS5A_MOUSE Sister chromatid cohesion protein PDS5 homolog A OS=Mus musculus OX=10090 GN=Pds5a PE=1 SV=3
8	Q6TRW4	0.0	1892	1447	0.681	0.629	PDS5B_RAT Sister chromatid cohesion protein PDS5 homolog B OS=Rattus norvegicus OX=10116 GN=Pds5b PE=1 SV=2
9	Q9NTI5	0.0	1892	1447	0.683	0.631	PDS5B_HUMAN Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1
10	Q9HFF5	1.60e-63	239	1205	0.194	0.215	PDS5_SCHPO Sister chromatid cohesion protein pds5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pds5 PE=1 SV=1
11	B6EUB3	8.18e-63	238	1605	0.190	0.158	PDS5A_ARATH Sister chromatid cohesion protein PDS5 homolog A OS=Arabidopsis thaliana OX=3702 GN=PDS5A PE=1 SV=1
12	F4I735	2.22e-52	204	1410	0.191	0.182	PDS5B_ARATH Sister chromatid cohesion protein PDS5 homolog B OS=Arabidopsis thaliana OX=3702 GN=PDS5B PE=3 SV=1
13	Q95U25	4.71e-47	176	415	0.084	0.270	Q95U25_DROME GH12788p OS=Drosophila melanogaster OX=7227 GN=pds5 PE=2 SV=1
14	G5EC05	5.46e-45	181	1570	0.237	0.202	G5EC05_CAEEL Cnd1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=evl-14 PE=1 SV=1
15	A9IYQ1	4.80e-32	129	302	0.046	0.202	A9IYQ1_HUMAN PDS5 cohesin associated factor B (Fragment) OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1
16	Q04264	1.58e-31	137	1277	0.165	0.173	PDS5_YEAST Sister chromatid cohesion protein PDS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDS5 PE=1 SV=1
17	Q5AWN4	7.27e-26	118	1506	0.126	0.112	Q5AWN4_EMENI BimD protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07296 PE=4 SV=1
18	A8MRD9	2.63e-22	106	826	0.055	0.090	PDS5D_ARATH Sister chromatid cohesion protein PDS5 homolog D OS=Arabidopsis thaliana OX=3702 GN=PDS5D PE=2 SV=3
19	Q9S9P0	1.21e-19	98.2	990	0.053	0.072	PDS5E_ARATH Sister chromatid cohesion protein PDS5 homolog E OS=Arabidopsis thaliana OX=3702 GN=PDS5E PE=2 SV=1
20	Q8GUP3	2.61e-17	90.5	873	0.040	0.062	PDS5C_ARATH Sister chromatid cohesion protein PDS5 homolog C OS=Arabidopsis thaliana OX=3702 GN=PDS5C PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12717 Cnd1	51	15.3	non-SMC mitotic condensation complex subunit 1
2	PF02985 HEAT	1e+02	14.6	HEAT repeat
3	PF13646 HEAT_2	0.98	21.2	HEAT repeats
4	PF13513 HEAT_EZ	6.7e+02	12.3	HEAT-like repeat
5	PF20168 PDS5	0	1027.6	Sister chromatid cohesion protein PDS5 protein
6	PF18714 PI-TkoII_IV	14	16.8	DNA polymerase II intein Domain IV

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303427

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275517	0.999	Sororin
2	9606.ENSP00000297338	0.999	Double-strand-break repair protein rad21 homolog
3	9606.ENSP00000298767	0.999	Wings apart-like protein homolog
4	9606.ENSP00000354720	0.999	Structural maintenance of chromosomes protein 3
5	9606.ENSP00000269214	0.998	N-acetyltransferase ESCO1
6	9606.ENSP00000323421	0.998	Structural maintenance of chromosomes protein 1A
7	9606.ENSP00000218089	0.997	Cohesin subunit SA-2
8	9606.ENSP00000372689	0.996	Cohesin subunit SA-1
9	9606.ENSP00000282516	0.995	Nipped-B-like protein
10	9606.ENSP00000306999	0.995	N-acetyltransferase ESCO2
11	9606.ENSP00000325290	0.959	Serine/threonine-protein kinase haspin
12	9606.ENSP00000378699	0.957	Cyclin-dependent kinase 1
13	9606.ENSP00000362674	0.954	Histone deacetylase 8
14	9606.ENSP00000262815	0.950	MAU2 chromatid cohesion factor homolog
15	9606.ENSP00000349961	0.925	Structural maintenance of chromosomes protein 4
16	9606.ENSP00000288207	0.923	G2/mitotic-specific cyclin-B2
17	9606.ENSP00000256442	0.921	G2/mitotic-specific cyclin-B1
18	9606.ENSP00000350036	0.920	Structural maintenance of chromosomes protein 1B
19	9606.ENSP00000257934	0.919	Separin
20	9606.ENSP00000251496	0.907	Condensin complex subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.406	organic cyclic compound binding
GO:1901363	0.403	heterocyclic compound binding
GO:0003676	0.379	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0065007	0.985	biological regulation
GO:0016043	0.981	cellular component organization
GO:0050794	0.978	regulation of cellular process
GO:0007049	0.955	cell cycle
GO:0022402	0.947	cell cycle process
GO:0051276	0.947	chromosome organization
GO:0048519	0.902	negative regulation of biological process
GO:1903047	0.896	mitotic cell cycle process
GO:0048523	0.877	negative regulation of cellular process
GO:0000280	0.849	nuclear division
GO:0007275	0.756	multicellular organism development
GO:0019222	0.737	regulation of metabolic process
GO:0001654	0.736	eye development
GO:0043010	0.730	camera-type eye development
GO:0140014	0.710	mitotic nuclear division
GO:0000819	0.707	sister chromatid segregation
GO:0060255	0.703	regulation of macromolecule metabolic process
GO:0000070	0.686	mitotic sister chromatid segregation
GO:0007062	0.636	sister chromatid cohesion
GO:0080090	0.509	regulation of primary metabolic process
GO:0051171	0.509	regulation of nitrogen compound metabolic process
GO:0031323	0.509	regulation of cellular metabolic process
GO:0019219	0.493	regulation of nucleobase-containing compound metabolic process
GO:0042127	0.440	regulation of cell population proliferation
GO:0008285	0.417	negative regulation of cell population proliferation
GO:0007064	0.374	mitotic sister chromatid cohesion
GO:0008152	0.350	metabolic process
GO:0071704	0.344	organic substance metabolic process
GO:0044238	0.309	primary metabolic process
GO:0051052	0.308	regulation of DNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016020	0.987	membrane
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0005829	0.966	cytosol
GO:0005694	0.949	chromosome
GO:0005886	0.941	plasma membrane
GO:0098687	0.875	chromosomal region
GO:0032991	0.777	protein-containing complex
GO:0000785	0.688	chromatin
GO:0000775	0.638	chromosome, centromeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]