StarFunc result for job id Q2HXU8

User Input

>input (276 residues)
MSEEVTYATLTFQDSAGARNNRDGNNLRKRGHPAPSPIWRHAALGLVTLCLMLLIGLVTL
GMMFLQISNDINSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSVLKRQ
EQMAIKLCQELIIHTSDHRCNPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLV
KIDSLEEKDFLMSQPLLMFSFFWLGLSWDSSGRSWFWEDGSVPSPSLFSTKELDQINGSK
GCAYFQKGNIYISRCSAEIFWICEKTAAPVKTEDLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2HXU8	1.000	1.000	2.207E-47	276	1.000	1.000	Q2HXU8.pdb.gz	CL12B_HUMAN C-type lectin domain family 12 member B OS=Homo sapiens OX=9606 GN=CLEC12B PE=1 SV=1
2	AFDB:Q8NC01	0.513	0.507	3.473E-19	280	0.312	0.307	Q8NC01.pdb.gz	CLC1A_HUMAN C-type lectin domain family 1 member A OS=Homo sapiens OX=9606 GN=CLEC1A PE=1 SV=2
3	AFDB:Q9TTK7	0.439	0.442	8.817E-18	274	0.246	0.248	Q9TTK7.pdb.gz	OLR1_PIG Oxidized low-density lipoprotein receptor 1 OS=Sus scrofa OX=9823 GN=OLR1 PE=2 SV=1
4	AFDB:Q5QGZ9	0.459	0.476	3.293E-17	265	0.326	0.340	Q5QGZ9.pdb.gz	CL12A_HUMAN C-type lectin domain family 12 member A OS=Homo sapiens OX=9606 GN=CLEC12A PE=1 SV=3
5	AFDB:A0A024RAU0	0.409	0.413	7.617E-17	273	0.272	0.275	A0A024RAU0.pdb.gz
6	AFDB:Q6UXN8	0.426	0.483	1.563E-16	241	0.264	0.303	Q6UXN8.pdb.gz	CLC9A_HUMAN C-type lectin domain family 9 member A OS=Homo sapiens OX=9606 GN=CLEC9A PE=1 SV=1
7	AFDB:Q9P126	0.525	0.625	6.986E-16	229	0.268	0.323	Q9P126.pdb.gz	CLC1B_HUMAN C-type lectin domain family 1 member B OS=Homo sapiens OX=9606 GN=CLEC1B PE=1 SV=2
8	AFDB:Q9JL99	0.501	0.599	1.821E-15	229	0.272	0.328	Q9JL99.pdb.gz	CLC1B_MOUSE C-type lectin domain family 1 member B OS=Mus musculus OX=10090 GN=Clec1b PE=1 SV=1
9	AFDB:Q8BRU4	0.426	0.490	5.353E-15	238	0.254	0.294	Q8BRU4.pdb.gz	CLC9A_MOUSE C-type lectin domain family 9 member A OS=Mus musculus OX=10090 GN=Clec9a PE=1 SV=1
10	AFDB:P20937	0.359	0.377	2.697E-14	262	0.236	0.248	P20937.pdb.gz	KLRA1_MOUSE T-cell surface glycoprotein YE1/48 OS=Mus musculus OX=10090 GN=Klra1 PE=1 SV=1
11	PDB:7wz8A	0.429	0.626	1.327E-10	180	0.127	0.194	7wz8A.pdb.gz
12	PDB:7qsrA	0.371	0.082	1.599E-8	1335	0.149	0.031	7qsrA.pdb.gz
13	PDB:1qddA	0.392	0.712	2.741E-8	144	0.105	0.201	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
14	PDB:4mthA	0.339	0.643	1.978E-7	139	0.127	0.252	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
15	PDB:1bj3B	0.333	0.717	5.158E-7	123	0.120	0.268	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
16	PDB:1gz2A	0.374	0.707	5.158E-7	139	0.116	0.230	1gz2A.pdb.gz
17	PDB:5f2qB	0.368	0.690	1.058E-6	135	0.105	0.215	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
18	PDB:1htnA	0.384	0.649	1.193E-6	156	0.134	0.237	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
19	PDB:2kv3A	0.344	0.664	1.428E-6	131	0.101	0.214	2kv3A.pdb.gz
20	PDB:3bx4C	0.303	0.597	1.428E-6	134	0.127	0.261	3bx4C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2HXU8	0.0	574	276	1.000	1.000	CL12B_HUMAN C-type lectin domain family 12 member B OS=Homo sapiens OX=9606 GN=CLEC12B PE=1 SV=1
2	Q5QGZ9	3.48e-31	118	265	0.337	0.351	CL12A_HUMAN C-type lectin domain family 12 member A OS=Homo sapiens OX=9606 GN=CLEC12A PE=1 SV=3
3	P78380	1.71e-29	114	273	0.290	0.293	OLR1_HUMAN Oxidized low-density lipoprotein receptor 1 OS=Homo sapiens OX=9606 GN=OLR1 PE=1 SV=1
4	Q8NC01	1.60e-27	109	280	0.330	0.325	CLC1A_HUMAN C-type lectin domain family 1 member A OS=Homo sapiens OX=9606 GN=CLEC1A PE=1 SV=2
5	Q9P126	1.61e-27	108	229	0.257	0.310	CLC1B_HUMAN C-type lectin domain family 1 member B OS=Homo sapiens OX=9606 GN=CLEC1B PE=1 SV=2
6	Q9JL99	1.62e-25	102	229	0.272	0.328	CLC1B_MOUSE C-type lectin domain family 1 member B OS=Mus musculus OX=10090 GN=Clec1b PE=1 SV=1
7	F5H7N8	3.88e-23	96.3	214	0.250	0.322	F5H7N8_HUMAN Oxidized low density lipoprotein receptor 1 (Fragment) OS=Homo sapiens OX=9606 GN=OLR1 PE=1 SV=1
8	Q9TTK7	2.53e-22	95.5	274	0.264	0.266	OLR1_PIG Oxidized low-density lipoprotein receptor 1 OS=Sus scrofa OX=9823 GN=OLR1 PE=2 SV=1
9	Q9BXN2	1.27e-21	92.8	247	0.297	0.332	CLC7A_HUMAN C-type lectin domain family 7 member A OS=Homo sapiens OX=9606 GN=CLEC7A PE=1 SV=1
10	Q8BRU4	8.67e-20	87.8	238	0.243	0.282	CLC9A_MOUSE C-type lectin domain family 9 member A OS=Mus musculus OX=10090 GN=Clec9a PE=1 SV=1
11	O70156	3.43e-19	88.2	364	0.217	0.165	OLR1_RAT Oxidized low-density lipoprotein receptor 1 OS=Rattus norvegicus OX=10116 GN=Olr1 PE=2 SV=1
12	Q80ZC8	3.82e-19	85.9	226	0.159	0.195	KLRE1_RAT Killer cell lectin-like receptor subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Klre1 PE=1 SV=1
13	O70215	6.45e-19	84.7	215	0.203	0.260	NKG2D_RAT NKG2-D type II integral membrane protein OS=Rattus norvegicus OX=10116 GN=Klrk1 PE=2 SV=1
14	P26718	6.51e-19	84.7	216	0.185	0.236	NKG2D_HUMAN NKG2-D type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRK1 PE=1 SV=2
15	Q8CJC7	9.70e-19	84.7	226	0.159	0.195	KLRE1_MOUSE Killer cell lectin-like receptor subfamily E member 1 OS=Mus musculus OX=10090 GN=Klre1 PE=1 SV=1
16	Q6UXN8	1.22e-18	84.7	241	0.246	0.282	CLC9A_HUMAN C-type lectin domain family 9 member A OS=Homo sapiens OX=9606 GN=CLEC9A PE=1 SV=1
17	O54709	1.72e-18	84.0	232	0.203	0.241	NKG2D_MOUSE NKG2-D type II integral membrane protein OS=Mus musculus OX=10090 GN=Klrk1 PE=1 SV=2
18	Q9R1G6	2.34e-18	84.3	266	0.250	0.259	Q9R1G6_MOUSE Killer cell lectin-like receptor subfamily A, member 10 OS=Mus musculus OX=10090 GN=Klra10 PE=2 SV=1
19	Q9NNX6	3.24e-17	82.8	404	0.221	0.151	CD209_HUMAN CD209 antigen OS=Homo sapiens OX=9606 GN=CD209 PE=1 SV=1
20	Q9H2X3	4.13e-17	82.4	399	0.207	0.143	CLC4M_HUMAN C-type lectin domain family 4 member M OS=Homo sapiens OX=9606 GN=CLEC4M PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14316 DUF4381	4.8e+02	12.4	Domain of unknown function (DUF4381)
2	PF00250 Forkhead	4e+02	12.6	Forkhead domain
3	PF00059 Lectin_C	7.1e-10	50.9	Lectin C-type domain
4	PF08391 Ly49	7.7e-05	34.4	Ly49-like protein, N-terminal region
5	PF11382 MctB	1.5e+02	13.5	Copper transport outer membrane protein, MctB
6	PF02086 MethyltransfD12	3.5e+02	12.2	D12 class N6 adenine-specific DNA methyltransferase
7	PF18595 Nuf2_DHR10-like	22	16.5	Nuf2, DHR10-like domain
8	PF05473 UL45	6.4e+02	11.4	UL45 protein, carbohydrate-binding C-type lectin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344563

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299665	0.755	C-type lectin domain family 4 member D
2	9606.ENSP00000363139	0.689	CD164 molecule like 2
3	9606.ENSP00000377914	0.642	Anamorsin
4	9606.ENSP00000301645	0.556	Cholesterol 7-alpha-monooxygenase
5	9606.ENSP00000347916	0.554	C-type lectin domain family 12 member A
6	9606.ENSP00000342962	0.553	Serine incorporator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0019903	0.394	protein phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0009987	0.988	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0007165	0.961	signal transduction
GO:0002682	0.957	regulation of immune system process
GO:0048583	0.945	regulation of response to stimulus
GO:0007166	0.870	cell surface receptor signaling pathway
GO:0080134	0.863	regulation of response to stress
GO:0050776	0.851	regulation of immune response
GO:0031341	0.775	regulation of cell killing
GO:0031347	0.692	regulation of defense response
GO:0032101	0.619	regulation of response to external stimulus
GO:0048519	0.590	negative regulation of biological process
GO:0002697	0.571	regulation of immune effector process
GO:0045088	0.516	regulation of innate immune response
GO:0002703	0.491	regulation of leukocyte mediated immunity
GO:0048518	0.488	positive regulation of biological process
GO:0019222	0.473	regulation of metabolic process
GO:0002683	0.381	negative regulation of immune system process
GO:0042269	0.374	regulation of natural killer cell mediated cytotoxicity
GO:0006950	0.356	response to stress
GO:0048522	0.355	positive regulation of cellular process
GO:0051239	0.342	regulation of multicellular organismal process
GO:0002764	0.338	immune response-regulating signaling pathway
GO:0060255	0.312	regulation of macromolecule metabolic process
GO:0010468	0.300	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.935	membrane-bounded organelle
GO:0043229	0.926	intracellular organelle
GO:0043231	0.893	intracellular membrane-bounded organelle
GO:0012505	0.889	endomembrane system
GO:0009986	0.765	cell surface
GO:0005737	0.737	cytoplasm
GO:0031982	0.536	vesicle
GO:0032991	0.470	protein-containing complex
GO:0098552	0.461	side of membrane
GO:0009897	0.450	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]