StarFunc result for job id Q2I0M4

User Input

>input (334 residues)
MRGPSWSRPRPLLLLLLLLSPWPVWAQVSATASPSGSLGAPDCPEVCTCVPGGLASCSAL
SLPAVPPGLSLRLRALLLDHNRVRALPPGAFAGAGALQRLDLRENGLHSVHVRAFWGLGA
LQLLDLSANQLEALAPGTFAPLRALRNLSLAGNRLARLEPAALGALPLLRSLSLQDNELA
ALAPGLLGRLPALDALHLRGNPWGCGCALRPLCAWLRRHPLPASEAETVLCVWPGRLTLS
PLTAFSDAAFSHCAQPLALRDLAVVYTLGPASFLVSLASCLALGSGLTACRARRRRLRTA
ALRPPRPPDPNPDPDPHGCASPADPGSPAAAAQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2I0M4	1.000	1.000	1.713E-58	334	1.000	1.000	Q2I0M4.pdb.gz	LRC26_HUMAN Leucine-rich repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=LRRC26 PE=1 SV=2
2	AFDB:Q6ZSA7	0.609	0.679	7.453E-17	298	0.272	0.305	Q6ZSA7.pdb.gz	LRC55_HUMAN Leucine-rich repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=LRRC55 PE=1 SV=3
3	AFDB:Q5VT99	0.630	0.709	7.882E-16	294	0.269	0.306	Q5VT99.pdb.gz	LRC38_HUMAN Leucine-rich repeat-containing protein 38 OS=Homo sapiens OX=9606 GN=LRRC38 PE=1 SV=1
4	AFDB:O75093	0.587	0.132	3.466E-15	1534	0.231	0.050	O75093.pdb.gz	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
5	AFDB:Q8N7C0	0.597	0.635	5.678E-15	313	0.240	0.256	Q8N7C0.pdb.gz	LRC52_HUMAN Leucine-rich repeat-containing protein 52 OS=Homo sapiens OX=9606 GN=LRRC52 PE=1 SV=2
6	AFDB:A0A0R4ITS3	0.461	0.422	7.470E-15	372	0.260	0.234	A0A0R4ITS3.pdb.gz	A0A0R4ITS3_DANRE Trophoblast glycoprotein a OS=Danio rerio OX=7955 GN=YF-296 PE=4 SV=1
7	AFDB:A8BB30	0.539	0.414	1.524E-14	444	0.198	0.149	A8BB30.pdb.gz
8	AFDB:Q5M8M9	0.607	0.643	1.610E-14	314	0.216	0.229	Q5M8M9.pdb.gz	LRC52_MOUSE Leucine-rich repeat-containing protein 52 OS=Mus musculus OX=10090 GN=Lrrc52 PE=1 SV=1
9	AFDB:Q8BHA1	0.532	0.356	1.797E-14	521	0.237	0.152	Q8BHA1.pdb.gz	LRC24_MOUSE Leucine-rich repeat-containing protein 24 OS=Mus musculus OX=10090 GN=Lrrc24 PE=2 SV=1
10	AFDB:F1RCV3	0.587	0.136	2.497E-14	1516	0.201	0.044	F1RCV3.pdb.gz	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1
11	PDB:5y31B	0.432	0.297	4.549E-8	511	0.153	0.100	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
12	PDB:7wrqA	0.384	0.247	4.081E-7	566	0.201	0.118	7wrqA.pdb.gz
13	PDB:2ft3F	0.271	0.296	4.311E-7	305	0.165	0.180	2ft3F.pdb.gz
14	PDB:3t6qA	0.467	0.268	1.037E-6	601	0.147	0.082	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
15	PDB:7p5vB	0.354	0.165	1.095E-6	732	0.132	0.060	7p5vB.pdb.gz
16	PDB:6gffI	0.384	0.247	2.634E-6	551	0.156	0.094	6gffI.pdb.gz
17	PDB:1xcdA	0.463	0.506	2.940E-6	305	0.123	0.134	1xcdA.pdb.gz
18	PDB:7tvfD	0.372	0.246	3.466E-6	515	0.105	0.068	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
19	PDB:7wv3A	0.404	0.221	5.998E-6	668	0.153	0.076	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
20	PDB:5yq5B	0.262	0.277	7.469E-6	306	0.138	0.150	5yq5B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2I0M4	0.0	624	334	1.000	1.000	LRC26_HUMAN Leucine-rich repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=LRRC26 PE=1 SV=2
2	Q6ZSA7	2.17e-31	121	298	0.284	0.319	LRC55_HUMAN Leucine-rich repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=LRRC55 PE=1 SV=3
3	Q5VT99	3.98e-29	115	294	0.266	0.303	LRC38_HUMAN Leucine-rich repeat-containing protein 38 OS=Homo sapiens OX=9606 GN=LRRC38 PE=1 SV=1
4	O75093	1.21e-26	113	1534	0.237	0.051	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
5	O88279	5.08e-26	111	1531	0.231	0.050	SLIT1_RAT Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1
6	Q80TR4	8.13e-26	110	1531	0.240	0.052	SLIT1_MOUSE Slit homolog 1 protein OS=Mus musculus OX=10090 GN=Slit1 PE=1 SV=2
7	Q8N7C0	7.47e-25	104	313	0.213	0.227	LRC52_HUMAN Leucine-rich repeat-containing protein 52 OS=Homo sapiens OX=9606 GN=LRRC52 PE=1 SV=2
8	D2XV92	3.09e-24	105	1513	0.231	0.051	D2XV92_CHICK SLIT1 (Fragment) OS=Gallus gallus OX=9031 GN=SLIT1 PE=2 SV=1
9	Q6UXK2	6.53e-24	104	745	0.237	0.106	ISLR2_HUMAN Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Homo sapiens OX=9606 GN=ISLR2 PE=1 SV=1
10	Q6WRI0	6.87e-24	105	2623	0.240	0.030	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
11	O75094	2.31e-23	103	1523	0.201	0.044	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
12	Q9WVC1	9.26e-23	101	766	0.207	0.090	SLIT2_RAT Slit homolog 2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Slit2 PE=1 SV=3
13	Q5M8M9	1.03e-22	98.6	314	0.198	0.210	LRC52_MOUSE Leucine-rich repeat-containing protein 52 OS=Mus musculus OX=10090 GN=Lrrc52 PE=1 SV=1
14	Q6GU68	2.45e-22	99.0	428	0.219	0.171	ISLR_MOUSE Immunoglobulin superfamily containing leucine-rich repeat protein OS=Mus musculus OX=10090 GN=Islr PE=1 SV=1
15	Q3S2J2	2.65e-22	100	1524	0.225	0.049	Q3S2J2_DANRE Slit homolog 1 protein precursor OS=Danio rerio OX=7955 GN=slit1a PE=1 SV=1
16	O88280	2.96e-22	100	1523	0.192	0.042	SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus OX=10116 GN=Slit3 PE=2 SV=1
17	Q3Y6S4	3.96e-22	99.8	1532	0.204	0.044	Q3Y6S4_DANRE Slit homolog 1b precursor OS=Danio rerio OX=7955 GN=slit1b PE=2 SV=1
18	A0A0R4IU60	4.03e-22	99.8	1531	0.204	0.044	A0A0R4IU60_DANRE Slit homolog 1b (Drosophila) OS=Danio rerio OX=7955 GN=slit1b PE=4 SV=1
19	Q9WVB4	4.72e-22	99.8	1523	0.192	0.042	SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus OX=10090 GN=Slit3 PE=2 SV=2
20	F1RCV3	5.03e-22	99.4	1516	0.180	0.040	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	0.041	25.2	Leucine Rich Repeat
2	PF12799 LRR_4	4.8e-07	41.2	Leucine Rich repeats (2 copies)
3	PF13855 LRR_8	4.5e-35	130.5	Leucine rich repeat
4	PF14580 LRR_9	0.23	22.5	Leucine-rich repeat
5	PF18016 SAM_3	4.4e+02	12.2	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360597

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286628	0.902	Calcium-activated potassium channel subunit alpha-1
2	9606.ENSP00000274629	0.756	Calcium-activated potassium channel subunit beta-1
3	9606.ENSP00000382770	0.730	Potassium channel subfamily U member 1
4	9606.ENSP00000252244	0.725	Keratin, type II cytoskeletal 1
5	9606.ENSP00000258111	0.699	Calcium-activated potassium channel subunit beta-4
6	9606.ENSP00000355166	0.678	Leucine-rich repeat-containing protein 10
7	9606.ENSP00000319370	0.601	Calcium-activated potassium channel subunit beta-3
8	9606.ENSP00000480998	0.507	Class E basic helix-loop-helix protein 23

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016247	0.999	channel regulator activity
GO:0005515	0.999	protein binding
GO:0046873	0.988	metal ion transmembrane transporter activity
GO:1901702	0.986	salt transmembrane transporter activity
GO:0022839	0.971	monoatomic ion gated channel activity
GO:0099106	0.949	ion channel regulator activity
GO:0005267	0.943	potassium channel activity
GO:0044325	0.874	transmembrane transporter binding
GO:0015459	0.809	potassium channel regulator activity
GO:0005249	0.689	voltage-gated potassium channel activity
GO:0099103	0.596	channel activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.987	regulation of biological process
GO:0006813	0.959	potassium ion transport
GO:0050794	0.958	regulation of cellular process
GO:0048518	0.840	positive regulation of biological process
GO:0098662	0.818	inorganic cation transmembrane transport
GO:0098655	0.807	monoatomic cation transmembrane transport
GO:0071805	0.775	potassium ion transmembrane transport
GO:0048522	0.733	positive regulation of cellular process
GO:0051049	0.678	regulation of transport
GO:1901381	0.616	positive regulation of potassium ion transmembrane transport
GO:2001259	0.612	positive regulation of cation channel activity
GO:1901018	0.612	positive regulation of potassium ion transmembrane transporter activity
GO:0050896	0.505	response to stimulus
GO:0032501	0.425	multicellular organismal process
GO:0065008	0.303	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005886	0.999	plasma membrane
GO:0098796	0.985	membrane protein complex
GO:0098797	0.975	plasma membrane protein complex
GO:0034703	0.975	cation channel complex
GO:0043227	0.966	membrane-bounded organelle
GO:0008076	0.965	voltage-gated potassium channel complex
GO:0005576	0.883	extracellular region
GO:0031982	0.871	vesicle
GO:0043230	0.792	extracellular organelle
GO:0065010	0.577	extracellular membrane-bounded organelle
GO:0005615	0.476	extracellular space
GO:0070062	0.432	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	0.943	K(+)(in) = K(+)(out)

[back to server]