StarFunc result for job id Q2KHM9

User Input

>input (967 residues)
MGPGQPASTCVHLAPRTQLDGRSDPKVLQTQNQLQFNRNVPTHSSNLAIRYSCPHAIRIE
KLKHSYNESYHCKDADCRVGPDLGSSVSFSVISQERLSYAVHLARRDVKRRQFEKHIKEH
HLRSQPQSSQKCGHTKYKIPDHRVERKESKSQAACQCSHQPSKVEISSSGAKVYLYSSHP
GQSDLTVPNSPPTHDPGLQPHPRIGDHKNISEQKSLLEVQRLQKELSSCIHKIEEVTKKD
RLEEALDPDEERRIRIRRQEQAARSARMLYVLQQQVKEIQEELDKLSPHKIKHTKKSWAM
SKLAAAHRGAIRALQMFVTQFTDRGEHPLPARCKELGSLIRQLSLCSVKLDADPSVPDVV
IDILQQIEALESLLEKKLSPKKVKKCFSEIRSRFPIGSQKALERWPSTSPKGERRPLTAK
DTFPQETSRPSVAKQLLADKYQPDTELPETQRLQSELDVLDADIVLEEGPFILDQSASFK
DEVLAVAKTKAGKKKPVTENVPFRKKDTLAPARQQGLRKAERGRQSQPHSKSRVQQTTVS
SRLKMNRQPVKDRKAPWIPPNPTSPPASPKCAAWLKVKTSPRDATKEPLQQEDPQEESHL
TGAVEHEAARLAWLDAETSKRLKELEELKAKEIDSMQKQRLDWLDAETSRRTKELNELKA
EEMYRLQQLSVSATHLADKVEEAVLDRLKPLLVKAQRVNSTTEANIHLKDGSSVNTAKAQ
PAQEVAAVDFESNNIRQLDDFLEDCASELWAVTHAKILGSETLATVEDSKDSPDLEIMMR
RMEEMEKYQESVRQRYNKIAYADPRLWMQEENNDQKISAISEKPLSPHPIRITKTVDRKD
PAVNIMLERPCNGNSLDESVGTEEGSEKREAPLLSLAEDSQQKEGRAPLFVPPGMQHSIG
DYCSRFEQYLRIISHEAVGSFNPWLIAESFSEELVDEALGAVAAELQDMCEDYAEAVFTS
EFLEAAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2KHM9	1.000	1.000	0.000	967	1.000	1.000	Q2KHM9.pdb.gz	MOONR_HUMAN Protein moonraker OS=Homo sapiens OX=9606 GN=KIAA0753 PE=1 SV=3
2	AFDB:B6RSP1	0.083	0.069	7.477E-6	1197	0.123	0.099	B6RSP1.pdb.gz	PKHA7_DANRE Pleckstrin homology domain-containing family A member 7 OS=Danio rerio OX=7955 GN=plekha7 PE=2 SV=2
3	AFDB:Q9M2K5	0.063	0.076	1.271E-4	784	0.122	0.151	Q9M2K5.pdb.gz	Q9M2K5_ARATH Uncharacterized protein F9D24.20 OS=Arabidopsis thaliana OX=3702 GN=ECAP PE=1 SV=1
4	AFDB:Q24595	0.063	0.051	5.388E-4	1293	0.142	0.106	Q24595.pdb.gz	XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster OX=7227 GN=Xpc PE=1 SV=2
5	AFDB:Q95SC8	0.099	0.148	8.404E-4	607	0.101	0.161	Q95SC8.pdb.gz	Q95SC8_DROME GM03282p OS=Drosophila melanogaster OX=7227 GN=Ccdc85 PE=2 SV=1
6	AFDB:O42874	0.055	0.042	1.386E-3	1462	0.081	0.053	O42874.pdb.gz	STU1_SCHPO Protein peg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=peg1 PE=1 SV=1
7	AFDB:J3KTH2	0.075	0.082	3.563E-3	867	0.122	0.136	J3KTH2.pdb.gz	J3KTH2_HUMAN HCG38478, isoform CRA_a OS=Homo sapiens OX=9606 GN=TAF4B PE=1 SV=1
8	AFDB:Q385X7	0.065	0.093	3.981E-3	646	0.100	0.150	Q385X7.pdb.gz	Q385X7_TRYB2 TATA element modulatory factor 1 TATA binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1950 PE=4 SV=1
9	AFDB:Q86YS3	0.095	0.138	6.209E-3	637	0.090	0.137	Q86YS3.pdb.gz	RFIP4_HUMAN Rab11 family-interacting protein 4 OS=Homo sapiens OX=9606 GN=RAB11FIP4 PE=1 SV=1
10	AFDB:Q9VGA8	0.056	0.081	1.024E-2	588	0.084	0.138	Q9VGA8.pdb.gz	Q9VGA8_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4066 PE=4 SV=1
11	PDB:2b5uA	0.056	0.106	2.712E-1	470	0.021	0.043	2b5uA.pdb.gz
12	PDB:1x8zA	0.066	0.296	3.581E-1	151	0.016	0.099	1x8zA.pdb.gz
13	PDB:6xz6A	0.058	0.193	3.581E-1	213	0.017	0.075	6xz6A.pdb.gz
14	PDB:3euhB	0.068	0.165	3.785E-1	321	0.032	0.097	3euhB.pdb.gz
15	PDB:1yo7A	0.075	0.422	4.230E-1	120	0.019	0.150	1yo7A.pdb.gz	Structure of the ColE1 rop protein at 1.7 A resolution
16	PDB:3pjaL	0.075	0.240	4.230E-1	223	0.026	0.112	3pjaL.pdb.gz
17	PDB:5xjt2	0.060	0.188	4.230E-1	217	0.033	0.147	5xjt2.pdb.gz	Structures of 7S mutant complexes
18	PDB:7nsuD	0.049	0.102	4.472E-1	420	0.014	0.033	7nsuD.pdb.gz
19	PDB:7zxkC	0.058	0.241	4.997E-1	166	0.030	0.175	7zxkC.pdb.gz
20	PDB:7aqsE	0.055	0.265	6.241E-1	159	0.020	0.119	7aqsE.pdb.gz	Identification of a Dps contamination in Mitomycin-C-induced expression of Colicin Ia.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2KHM9	0.0	1987	967	1.000	1.000	MOONR_HUMAN Protein moonraker OS=Homo sapiens OX=9606 GN=KIAA0753 PE=1 SV=3
2	X1WC30	5.98e-115	376	878	0.337	0.371	X1WC30_DANRE Protein moonraker isoform X1 OS=Danio rerio OX=7955 GN=si:dkey-243i1.1 PE=4 SV=1
3	Q8IDX6	0.17	38.5	3130	0.030	0.009	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
4	G0SDQ4	3.3	34.3	1169	0.028	0.023	NUP85_CHATD Nucleoporin NUP85 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP85 PE=1 SV=1
5	Q386T1	5.5	33.5	862	0.029	0.032	Q386T1_TRYB2 BRO1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.18.0002 PE=4 SV=1
6	O88382	7.6	33.1	1277	0.028	0.021	MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Magi2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15718 MNR	0	1784.2	Protein moonraker

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355250

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344314	0.910	Oral-facial-digital syndrome 1 protein
2	9606.ENSP00000420180	0.837	Coiled-coil domain-containing protein 14
3	9606.ENSP00000255759	0.834	LisH domain-containing protein FOPNL
4	9606.ENSP00000317144	0.755	Progesterone-induced-blocking factor 1
5	9606.ENSP00000336524	0.736	Centrosomal protein of 63 kDa
6	9606.ENSP00000378167	0.717	Microtubule-binding protein required for ciliogenesis . May function in ciliogenesis by mediating the transport of proteins like BBS4 to the cilium, but also through the organization of the centriolar satellites . Plays a role in retina morphogenesis and/or homeostasis (By similarity).
7	9606.ENSP00000309836	0.709	Coiled-coil domain-containing protein 13
8	9606.ENSP00000221421	0.700	Lutropin subunit beta
9	9606.ENSP00000257287	0.674	Centrosomal protein of 135 kDa
10	9606.ENSP00000263468	0.668	Centrosomal protein of 126 kDa
11	9606.ENSP00000383808	0.658	Coiled-coil domain containing 18
12	9606.ENSP00000384792	0.646	WD repeat-containing protein 62
13	9606.ENSP00000261475	0.632	Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
14	9606.ENSP00000329093	0.632	Tryptophan hydroxylase 2
15	9606.ENSP00000368931	0.625	Coiled-coil domain containing 112
16	9606.ENSP00000327077	0.607	Pericentriolar material 1 protein
17	9606.ENSP00000292314	0.601	Coiled-coil domain containing 12
18	9606.ENSP00000393583	0.599	Centrosomal protein of 131 kDa
19	9606.ENSP00000359600	0.593	Outer dense fiber of sperm tails 2 like
20	9606.ENSP00000370337	0.585	Centrosomal protein of 152 kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0006996	0.979	organelle organization
GO:0060271	0.974	cilium assembly
GO:0051641	0.969	cellular localization
GO:1905508	0.946	protein localization to microtubule organizing center
GO:0071539	0.405	protein localization to centrosome
GO:0065007	0.353	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0034451	0.998	centriolar satellite
GO:0043227	0.901	membrane-bounded organelle
GO:0005929	0.740	cilium
GO:0070013	0.333	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]