StarFunc result for job id Q2KHN1

User Input

>input (245 residues)
MGGGYDLNLFASPPDSNFVCSVCHGVLKRPARLPCSHIFCKKCILRWLARQKTCPCCRKE
VKRKKVVHMNKLRKTIGRLEVKCKNADAGCIVTCPLAHRKGHQDSCPFELTACPNEGCTS
QVPRGTLAEHRQHCQQGSQQRCPLGCGATLDPAERARHNCYRELHNAWSVRQERRRPLLL
SLLRRVRWLDQATSVVRRELAELSNFLEEDTALLEGAPQEEAEAAPEGNVGAEVVGEPRA
NIPCK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2KHN1	1.000	1.000	8.962E-49	245	1.000	1.000	Q2KHN1.pdb.gz	RN151_HUMAN RING finger protein 151 OS=Homo sapiens OX=9606 GN=RNF151 PE=1 SV=1
2	AFDB:Q9CQ29	0.632	0.646	1.368E-35	239	0.678	0.695	Q9CQ29.pdb.gz	RN151_MOUSE RING finger protein 151 OS=Mus musculus OX=10090 GN=Rnf151 PE=1 SV=1
3	AFDB:Q69ZS0	0.548	0.141	8.399E-18	1063	0.249	0.057	Q69ZS0.pdb.gz	PZRN3_MOUSE E3 ubiquitin-protein ligase PDZRN3 OS=Mus musculus OX=10090 GN=Pdzrn3 PE=1 SV=3
4	AFDB:Q9VUV7	0.390	0.309	4.097E-15	315	0.245	0.190	Q9VUV7.pdb.gz	Q9VUV7_DROME E3 ubiquitin-protein ligase NRDP1 OS=Drosophila melanogaster OX=7227 GN=elgi PE=2 SV=1
5	AFDB:A0A024QZ59	0.545	0.291	1.030E-14	470	0.163	0.085	A0A024QZ59.pdb.gz
6	AFDB:F6SA91	0.534	0.311	1.175E-14	437	0.163	0.092	F6SA91.pdb.gz	F6SA91_HUMAN TNF receptor-associated factor OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1
7	AFDB:Q7T1K2	0.551	0.297	1.990E-14	470	0.171	0.089	Q7T1K2.pdb.gz	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1
8	AFDB:Q9Y4K3	0.430	0.205	4.105E-14	522	0.245	0.115	Q9Y4K3.pdb.gz	TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1
9	AFDB:O00463	0.459	0.209	5.343E-14	557	0.237	0.104	O00463.pdb.gz	TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2
10	AFDB:P70191	0.512	0.235	9.664E-14	558	0.245	0.108	P70191.pdb.gz	TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1
11	PDB:5dkaA	0.285	0.665	1.278E-6	96	0.114	0.292	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:4r8pL	0.263	0.254	1.671E-4	254	0.106	0.102	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:5a31B	0.183	0.495	4.201E-4	84	0.086	0.250	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
14	PDB:7z36B	0.220	0.135	1.128E-3	446	0.159	0.087	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
15	PDB:5gm6a	0.229	0.438	1.287E-3	123	0.065	0.130	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:7jzvA	0.223	0.216	2.486E-3	253	0.069	0.067	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
17	PDB:3m62A	0.240	0.063	3.029E-3	955	0.065	0.017	3m62A.pdb.gz
18	PDB:2c2lA	0.254	0.222	6.675E-3	281	0.029	0.025	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
19	PDB:7oikA	0.218	0.013	6.675E-3	4426	0.086	0.005	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
20	PDB:5l9uB	0.164	0.530	1.290E-2	71	0.073	0.254	5l9uB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2KHN1	0.0	501	245	1.000	1.000	RN151_HUMAN RING finger protein 151 OS=Homo sapiens OX=9606 GN=RNF151 PE=1 SV=1
2	Q9CQ29	1.52e-109	317	239	0.669	0.686	RN151_MOUSE RING finger protein 151 OS=Mus musculus OX=10090 GN=Rnf151 PE=1 SV=1
3	Q69ZS0	6.50e-20	90.5	1063	0.229	0.053	PZRN3_MOUSE E3 ubiquitin-protein ligase PDZRN3 OS=Mus musculus OX=10090 GN=Pdzrn3 PE=1 SV=3
4	Q7ZW16	6.99e-18	83.2	318	0.192	0.148	RNF41_DANRE E3 ubiquitin-protein ligase NRDP1 OS=Danio rerio OX=7955 GN=rnf41 PE=2 SV=1
5	Q9VUV7	3.44e-17	81.3	315	0.188	0.146	Q9VUV7_DROME E3 ubiquitin-protein ligase NRDP1 OS=Drosophila melanogaster OX=7227 GN=elgi PE=2 SV=1
6	Q9H4P4	5.61e-17	80.5	317	0.192	0.148	RNF41_HUMAN E3 ubiquitin-protein ligase NRDP1 OS=Homo sapiens OX=9606 GN=RNF41 PE=1 SV=2
7	Q8BH75	5.72e-17	80.5	317	0.192	0.148	RNF41_MOUSE E3 ubiquitin-protein ligase NRDP1 OS=Mus musculus OX=10090 GN=Rnf41 PE=1 SV=1
8	P70191	3.40e-13	70.9	558	0.167	0.073	TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1
9	O00463	7.35e-12	66.6	557	0.176	0.077	TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2
10	E1C626	1.88e-10	62.8	545	0.208	0.094	E1C626_CHICK TNF receptor-associated factor OS=Gallus gallus OX=9031 GN=TRAF6 PE=1 SV=2
11	P70196	2.77e-10	62.0	530	0.151	0.070	TRAF6_MOUSE TNF receptor-associated factor 6 OS=Mus musculus OX=10090 GN=Traf6 PE=1 SV=2
12	Q61382	4.85e-10	61.2	470	0.151	0.079	TRAF4_MOUSE TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2
13	B5DF45	4.93e-10	61.2	530	0.151	0.070	TRAF6_RAT TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1
14	Q6DJN2	4.98e-10	61.2	556	0.163	0.072	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
15	Q9Y4K3	4.99e-10	61.2	522	0.151	0.071	TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1
16	Q3MV19	5.83e-10	61.2	556	0.171	0.076	TRF6A_XENLA TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1
17	Q6ZMN7	1.07e-09	60.5	1036	0.135	0.032	PZRN4_HUMAN PDZ domain-containing RING finger protein 4 OS=Homo sapiens OX=9606 GN=PDZRN4 PE=1 SV=3
18	Q9BUZ4	1.10e-09	60.1	470	0.151	0.079	TRAF4_HUMAN TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1
19	Q6IWL4	1.15e-09	60.1	542	0.196	0.089	TRAF6_DANRE TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2
20	Q13114	1.16e-09	60.1	568	0.159	0.069	TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	0.32	22.2	Prokaryotic RING finger family 4
2	PF03145 Sina	1.5	20.3	Seven in absentia protein family
3	PF04564 U-box	0.0093	27.4	U-box domain
4	PF12861 zf-ANAPC11	7.3	18.1	Anaphase-promoting complex subunit 11 RING-H2 finger
5	PF00097 zf-C3HC4	0.0035	28.5	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	5.7e-06	37.4	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	0.00011	33.3	Zinc finger, C3HC4 type (RING finger)
8	PF15227 zf-C3HC4_4	0.069	24.6	zinc finger of C3HC4-type, RING
9	PF12678 zf-rbx1	0.086	24.4	RING-H2 zinc finger domain
10	PF13639 zf-RING_2	0.00011	33.7	Ring finger domain
11	PF14634 zf-RING_5	0.025	25.9	zinc-RING finger domain
12	PF14835 zf-RING_6	8.9	17.6	zf-RING of BARD1-type protein
13	PF13445 zf-RING_UBOX	0.00031	32.0	RING-type zinc-finger
14	PF02176 zf-TRAF	0.025	26.6	TRAF-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000456566

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222033	0.701	E3 ubiquitin-protein ligase ZNRF4
2	9606.ENSP00000292363	0.648	E3 ubiquitin-protein ligase RNF126
3	9606.ENSP00000355077	0.634	Non-structural maintenance of chromosomes element 1 homolog
4	9606.ENSP00000341680	0.581	Dysbindin
5	9606.ENSP00000456340	0.548	DET1 homolog
6	9606.ENSP00000344489	0.524	E3 ubiquitin-protein ligase RNF133
7	9606.ENSP00000325682	0.505	Olfactory receptor 2B11
8	9606.ENSP00000327604	0.502	Tripartite motif containing 49

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004842	0.798	ubiquitin-protein transferase activity
GO:0061630	0.536	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.990	primary metabolic process
GO:0071704	0.988	organic substance metabolic process
GO:0006807	0.970	nitrogen compound metabolic process
GO:0043170	0.969	macromolecule metabolic process
GO:0050789	0.965	regulation of biological process
GO:0050794	0.963	regulation of cellular process
GO:0009987	0.962	cellular process
GO:0019538	0.954	protein metabolic process
GO:0036211	0.858	protein modification process
GO:0070647	0.776	protein modification by small protein conjugation or removal
GO:0016567	0.752	protein ubiquitination
GO:0044237	0.644	cellular metabolic process
GO:0019941	0.579	modification-dependent protein catabolic process
GO:0006511	0.567	ubiquitin-dependent protein catabolic process
GO:0050896	0.534	response to stimulus
GO:0048518	0.446	positive regulation of biological process
GO:0019222	0.430	regulation of metabolic process
GO:0048583	0.413	regulation of response to stimulus
GO:0060255	0.413	regulation of macromolecule metabolic process
GO:0048522	0.349	positive regulation of cellular process
GO:0048519	0.309	negative regulation of biological process
GO:0023051	0.301	regulation of signaling
GO:0010646	0.301	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031981	0.992	nuclear lumen
GO:0005737	0.968	cytoplasm
GO:0005829	0.930	cytosol
GO:0005654	0.818	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.798	Transferases.

[back to server]