StarFunc result for job id Q2KHR2

User Input

>input (1363 residues)
MSSSRAQQMHAFSWIRNTLEEHPETSLPKQEVYDEYKSYCDNLGYHPLSAADFGKIMKNV
FPNMKARRLGTRGKSKYCYSGLRKKAFVHMPTLPNLDFHKTGDGLEGAEPSGQLQNIDEE
VISSACRLVCEWAQKVLSQPFDTVLELARFLVKSHYIGTKSMAALTVMAAAPAGMKGITQ
PSAFIPTAESNSFQPQVKTLPSPIDAKQQLQRKIQKKQQEQKLQSPLPGESAAKKSESAT
SNGVTNLPNGNPSILSPQPIGIVVAAVPSPIPVQRTRQLVTSPSPMSSSDGKVLPLNVQV
VTQHMQSVKQAPKTPQNVPASPGGDRSARHRYPQILPKPANTSALTIRSPTTVLFTSSPI
KTAVVPASHMSSLNVVKMTTISLTPSNSNTPLKHSASVSSATGTTEESRSVPQIKNGSVV
SLQSPGSRSSSAGGTSAVEVKVEPETSSDEHPVQCQENSDEAKAPQTPSALLGQKSNTDG
ALQKPSNEGVIEIKATKVCDQRTKCKSRCNEMLPGTSTGNNQSTITLSVASQNLTFTSSS
SPPNGDSINKDPKLCTKSPRKRLSSTLQETQVPPVKKPIVEQLSAATIEGQKQGSVKKDQ
KVPHSGKTEGSTAGAQIPSKVSVNVSSHIGANQPLNSSALVISDSALEQQTTPSSSPDIK
VKLEGSVFLLDSDSKSVGSFNPNGWQQITKDSEFISASCEQQQDISVMTIPEHSDINDLE
KSVWELEGMPQDTYSQQLHSQIQESSLNQIQAHSSDQLPLQSELKEFEPSVSQTNESYFP
FDDELTQDSIVEELVLMEQQMSMNNSHSYGNCLGMTLQSQSVTPGAPMSSHTSSTHFYHP
IHSNGTPIHTPTPTPTPTPTPTPTPTPTSEMIAGSQSLSRESPCSRLAQTTPVDSALGSS
RHTPIGTPHSNCSSSVPPSPVECRNPFAFTPISSSMAYHDASIVSSSPVKPMQRPMATHP
DKTKLEWMNNGYSGVGNSSVSGHGILPSYQELVEDRFRKPHAFAVPGQSYQSQSRHHDTH
FGRLTPVSPVQHQGATVNNTNKQEGFAVPAPLDNKGTNSSASSNFRCRSVSPAVHRQRNL
SGSTLYPVSNIPRSNVTPFGSPVTPEVHVFTNVHTDACANNIAQRSQSVPLTVMMQTAFP
NALQKQANSKKITNVLLSKLDSDNDDAVRGLGMNNLPSNYTARMNLTQILEPSTVFPSAN
PQNMIDSSTSVYEFQTPSYLTKSNSTGQINFSPGDNQAQSEIGEQQLDFNSTVKDLLSGD
SLQTNQQLVGQGASDLTNTASDFSSDIRLSSELSGSINDLNTLDPNLLFDPGRQQGQDDE
ATLEELKNDPLFQQICSESMNSMTSSGFEWIESKDHPTVEMLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2KHR2	1.000	1.000	0.000	1363	1.000	1.000	Q2KHR2.pdb.gz	RFX7_HUMAN DNA-binding protein RFX7 OS=Homo sapiens OX=9606 GN=RFX7 PE=1 SV=1
2	AFDB:Q68CP9	0.060	0.045	4.145E-4	1835	0.151	0.112	Q68CP9.pdb.gz	ARID2_HUMAN AT-rich interactive domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARID2 PE=1 SV=2
3	AFDB:Q6ZPE7	0.036	0.050	4.989E-3	858	0.109	0.172	Q6ZPE7.pdb.gz	Q6ZPE7_MOUSE MKIAA3015 protein (Fragment) OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1
4	AFDB:P49750	0.036	0.028	2.362E-2	2146	0.164	0.104	P49750.pdb.gz	YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4
5	PDB:1xsdA	0.047	0.307	2.574E-2	125	0.013	0.144	1xsdA.pdb.gz	Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
6	AFDB:Q54T92	0.042	0.031	6.801E-2	2107	0.131	0.084	Q54T92.pdb.gz	Q54T92_DICDI Rab GTPase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=comB PE=4 SV=1
7	PDB:2qbyA	0.045	0.145	8.390E-2	366	0.008	0.030	2qbyA.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
8	AFDB:A1ZBW7	0.041	0.039	1.051E-1	1469	0.138	0.128	A1ZBW7.pdb.gz	WASC2_DROME WASH complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=FAM21 PE=1 SV=1
9	PDB:7tjjI	0.048	0.147	1.219E-1	380	0.009	0.032	7tjjI.pdb.gz	A mechanism of origin licensing control through autoinhibition of S. cerevisiae ORC·DNA·Cdc6.
10	PDB:7odrO	0.032	0.160	1.883E-1	154	0.016	0.143	7odrO.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
11	PDB:7vo0G	0.043	0.293	2.004E-1	131	0.010	0.099	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
12	AFDB:X5M5N0	0.046	0.036	2.672E-1	1850	0.138	0.102	X5M5N0.pdb.gz	WNK_CAEEL Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans OX=6239 GN=wnk-1 PE=1 SV=1
13	AFDB:A0A2R8Q4C2	0.034	0.027	3.026E-1	2404	0.145	0.082	A0A2R8Q4C2.pdb.gz
14	PDB:7ctfA	0.044	0.383	3.098E-1	102	0.007	0.098	7ctfA.pdb.gz	Structural insight into the assembly and conformational activation of human origin recognition complex.
15	AFDB:Q9BX66	0.035	0.036	3.220E-1	1292	0.126	0.133	Q9BX66.pdb.gz	SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3
16	AFDB:M9ND53	0.036	0.029	3.427E-1	2047	0.146	0.097	M9ND53.pdb.gz	M9ND53_DROME Taiman, isoform G OS=Drosophila melanogaster OX=7227 GN=tai PE=1 SV=1
17	PDB:2o03A	0.043	0.319	3.508E-1	129	0.008	0.085	2o03A.pdb.gz	Crystal structure and function of the zinc uptake regulator FurB from Mycobacterium tuberculosis.
18	PDB:5svah	0.037	0.255	3.973E-1	118	0.005	0.059	5svah.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
19	PDB:6h1cB	0.043	0.300	3.973E-1	134	0.004	0.045	6h1cB.pdb.gz	Ferric uptake regulator with Mn and Zn form Pseudomonas aeruginosa
20	PDB:5hs7A	0.038	0.359	4.787E-1	102	0.006	0.078	5hs7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2KHR2	0.0	2790	1363	1.000	1.000	RFX7_HUMAN DNA-binding protein RFX7 OS=Homo sapiens OX=9606 GN=RFX7 PE=1 SV=1
2	Q9JL61	5.64e-46	179	658	0.075	0.155	RFX5_MOUSE DNA-binding protein Rfx5 OS=Mus musculus OX=10090 GN=Rfx5 PE=1 SV=2
3	F8W689	6.41e-46	177	596	0.058	0.133	F8W689_HUMAN Regulatory factor X5 (Fragment) OS=Homo sapiens OX=9606 GN=RFX5 PE=1 SV=1
4	P48382	6.90e-46	178	616	0.058	0.128	RFX5_HUMAN DNA-binding protein RFX5 OS=Homo sapiens OX=9606 GN=RFX5 PE=1 SV=1
5	Q09555	7.18e-14	79.0	805	0.025	0.042	DAF19_CAEEL RFX-like transcription factor daf-19 OS=Caenorhabditis elegans OX=6239 GN=daf-19 PE=1 SV=3
6	P48383	2.34e-13	77.4	766	0.021	0.038	SAK1_SCHPO Protein sak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sak1 PE=1 SV=2
7	P48377	6.64e-13	76.3	963	0.023	0.033	RFX1_MOUSE MHC class II regulatory factor RFX1 OS=Mus musculus OX=10090 GN=Rfx1 PE=1 SV=2
8	P22670	6.98e-13	76.3	979	0.023	0.033	RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens OX=9606 GN=RFX1 PE=1 SV=2
9	Q32NR3	1.22e-12	75.1	694	0.022	0.043	RFX2_XENLA DNA-binding protein RFX2 OS=Xenopus laevis OX=8355 GN=rfx2 PE=2 SV=1
10	B2GV50	1.65e-12	74.7	692	0.022	0.043	RFX2_RAT DNA-binding protein RFX2 OS=Rattus norvegicus OX=10116 GN=Rfx2 PE=1 SV=1
11	Q9U1K2	1.79e-12	74.7	897	0.024	0.037	Q9U1K2_DROME RFX transcription factor OS=Drosophila melanogaster OX=7227 GN=Rfx PE=2 SV=1
12	P48379	1.81e-12	74.3	717	0.022	0.042	RFX2_MOUSE DNA-binding protein RFX2 OS=Mus musculus OX=10090 GN=Rfx2 PE=1 SV=2
13	Q5EAP5	1.85e-12	74.3	734	0.022	0.041	RFX2_DANRE DNA-binding protein RFX2 OS=Danio rerio OX=7955 GN=rfx2 PE=2 SV=1
14	Q9VGZ6	1.91e-12	74.7	897	0.022	0.033	Q9VGZ6_DROME Rfx, isoform J OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=2
15	A8JQX0	2.00e-12	74.3	889	0.022	0.034	A8JQX0_DROME Rfx, isoform I OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=2
16	A0A0B4K6P1	2.19e-12	74.3	911	0.022	0.033	A0A0B4K6P1_DROME Rfx, isoform C OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
17	A0A0B4K653	2.22e-12	74.3	919	0.022	0.033	A0A0B4K653_DROME Rfx, isoform H OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
18	P48378	2.25e-12	74.3	723	0.022	0.041	RFX2_HUMAN DNA-binding protein RFX2 OS=Homo sapiens OX=9606 GN=RFX2 PE=1 SV=2
19	P48380	2.39e-12	73.9	749	0.021	0.039	RFX3_HUMAN Transcription factor RFX3 OS=Homo sapiens OX=9606 GN=RFX3 PE=1 SV=2
20	P48381	2.54e-12	73.9	749	0.021	0.039	RFX3_MOUSE Transcription factor RFX3 OS=Mus musculus OX=10090 GN=Rfx3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09079 Cdc6_C	43	15.5	CDC6, C terminal winged helix domain
2	PF13427 DUF4111	1.6e+02	13.8	Domain of unknown function (DUF4111)
3	PF11557 Omp_AT	7.4e+02	10.5	Solitary outer membrane autotransporter beta-barrel domain
4	PF03288 Pox_D5	0.86	21.5	Poxvirus D5 protein-like
5	PF02257 RFX_DNA_binding	1.1e-26	104.6	RFX DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000453281

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305071	0.962	DNA-binding protein RFXANK
2	9606.ENSP00000296785	0.926	Ankyrin repeat family A protein 2
3	9606.ENSP00000478589	0.799	Tetratricopeptide repeat protein 25
4	9606.ENSP00000374529	0.724	Cyclin-K
5	9606.ENSP00000322885	0.695	Probable E3 ubiquitin-protein ligase DTX2
6	9606.ENSP00000333012	0.688	Calcium-responsive transactivator
7	9606.ENSP00000255476	0.682	Regulatory factor X-associated protein
8	9606.ENSP00000257600	0.671	E3 ubiquitin-protein ligase DTX1
9	9606.ENSP00000342322	0.630	Transmembrane 7 superfamily member 3
10	9606.ENSP00000401536	0.587	DNA-binding protein RFX8
11	9606.ENSP00000272748	0.580	Endoplasmic reticulum junction formation protein lunapark
12	9606.ENSP00000287218	0.553	Zinc finger AN1-type containing 3
13	9606.ENSP00000381932	0.525	Dual specificity tyrosine-phosphorylation-regulated kinase 1A
14	9606.ENSP00000215912	0.520	Phosphoinositide-3-kinase-interacting protein 1
15	9606.ENSP00000485010	0.507	MHC class II transactivator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0000976	0.656	transcription cis-regulatory region binding
GO:0000977	0.543	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0140110	0.380	transcription regulator activity
GO:0000981	0.371	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0019222	0.989	regulation of metabolic process
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0031323	0.971	regulation of cellular metabolic process
GO:0006357	0.955	regulation of transcription by RNA polymerase II
GO:0048518	0.950	positive regulation of biological process
GO:0048522	0.899	positive regulation of cellular process
GO:0009987	0.797	cellular process
GO:0045935	0.748	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.731	positive regulation of RNA metabolic process
GO:0048519	0.723	negative regulation of biological process
GO:0045893	0.720	positive regulation of DNA-templated transcription
GO:0010605	0.698	negative regulation of macromolecule metabolic process
GO:0048523	0.443	negative regulation of cellular process
GO:0050896	0.389	response to stimulus
GO:0045944	0.328	positive regulation of transcription by RNA polymerase II
GO:0032502	0.320	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.888	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]