StarFunc result for job id Q2KHR3

User Input

>input (1735 residues)
MNFLSTAESRTAQAAASGTTLLPQFRAPSWQTGMHSSAATELFATGPLPSTGTLPPSLSA
YQHPTTFSNRNFATTSPLVLQDSTFNTTSNGILSHHDPLLQIKTSQGTVPTALAFERLGS
SVLSNSIPPQSSTYRSAQESAPHLLQPQFSLLPSALGGSQQTPQAYSSTLFTSSTASIER
ALLRECSVIKHHQRPSGTQSIQAQLTGSQHSLHSYLSNSSVVNFQETTRQSSLSCSPIGD
STQVSNGGLQQKTSQVSVELAQSYSSAIPSSGYPPSTTKIKSCSTEQPLTSTKTPKPQSI
IPPVQTLSYSKPLHNQSSVISGQAQIYSTAQLPSLLSVSQSQNYGLVQPHNVPSIVHSQV
YRSSKVEKLPPLYKTLTFSGSSQTVTPENQTLNYSSNQQEVLSSVTNENYPAQTRDLSSV
SQSQSYSSGHSQGLSPVSQTQVSYSSQSQVLSVVSLSESYASGESLTLTAPSLSYSSASR
AQNLPDSSPTQNYISMHSSQNVQTQESSSPQSQKFLPAVQSSSFASSTHCQTLQNNITSP
DPKSYAERKLDSDVYPSSKQEDGFPMQELQVLQPQASLESSTQRLSDGEINAQESTYKVS
KADDRYSQSVIRSNSRLEDQVIGVALQASKKEESVVGSVTQLNQQIGQVNNAATLDLKNS
TNLIQTPQIRLNTKDLKQQHPLILKVHESKVQEQHDQIINASSQIQIPNHALGHGHQASL
PNTQVLLDSACDLQILQQSILQAGLGQVKASLQAQRVQSPQQIVHPFLQMEGHVIQSNGD
HSQQQLHPQNSEVMKMDLSESSKPLQQHLTTKGHFSETNQHDSKNQFVSLGSMCFPEAVL
LSDERNILSNVDDILAATAAACGVTPTDFSKSTSNETMQAVEDGDSKSHFQQSLDVRHVT
SDFNSMTATVGKPQNINDTSLNGNQVTVNLSPVPALQSKMTLDQQHIETPGQNIPTKVTS
AVVGPSHEVQEQSSGPFKKQSATNLESEEDSEAPVDSTLNNNRNQEFVSSSRSISGENAT
SESEFTLGGDDSGVSMNPARSALALLAMAQSGDAVSVKIEEENQDLMHFNLQKKRAKGKG
QVKEEDNSNQKQLKRPAQGKRQNPRGTDIYLPYTPPSSESCHDGYQHQEKMRQKIKEVEE
KQPEVKTGFIASFLDFLKSGPKQQFSTLAVRMPNRTRRPGTQMVRTFCPPPLPKPSSTTP
TPLVSETGGNSPSDKVDNELKNLEHLSSFSSDEDDPGYSQDAYKSVSTPLTTLDATSDKK
KKTEALQVATTSPTANTTGTATTSSTTVGAVKQEPLHSTSYAVNILENISSSESSKPIEL
DGLPSDQFAKGQDTVAIEGFTDEEDTESGGEGQYRERDEFVVKIEDIETFKEALKTGKEP
PAIWKVQKALLQKFVPEIRDGQREFAATNSYLGYFGDAKSKYKRIYVKFIENANKKEYVR
VCSKKPRNKPSQTIRTVQAKPSSSSKTSDPLASKTTTTKAPSVKPKVKQPKVKAEPPPKK
RKKWKEEFSSSQSDSSPEIHTSSSDDEEFEPPAPFVTRFLNTRAMKETFKSYMELLVSIA
LDPDTMQALEKSNDELLLPHMKKIDGMLNDNRKRLLLNLHLDQSFKNALESFPELTIITR
DSKAKSGGTAISKIKMNGKAYNKKTLRTSKTTTKSAQEFAVDPEKIQLYSLYHSLHHYKY
HVYLICKDEISSVQKKNEDLGQEEIVQLCMKNVKWVEDLFEKFGELLNHVQQKCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3LHL9	0.035	0.036	1.109E-3	1658	0.130	0.136	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
2	AFDB:Q99KW3	0.041	0.036	2.995E-3	2014	0.144	0.124	Q99KW3.pdb.gz	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
3	AFDB:Q8IQT4	0.032	0.028	5.911E-3	2133	0.134	0.109	Q8IQT4.pdb.gz	Q8IQT4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Nirvana PE=1 SV=1
4	AFDB:Q3URK3	0.038	0.034	1.051E-2	2007	0.122	0.106	Q3URK3.pdb.gz	TET1_MOUSE Methylcytosine dioxygenase TET1 OS=Mus musculus OX=10090 GN=Tet1 PE=1 SV=3
5	AFDB:A1ZBJ6	0.036	0.042	1.107E-2	1379	0.089	0.112	A1ZBJ6.pdb.gz	A1ZBJ6_DROME Rad, Gem/Kir family member 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Rgk1 PE=4 SV=2
6	AFDB:X2JEM2	0.030	0.025	1.107E-2	2326	0.118	0.088	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
7	AFDB:F1M842	0.042	0.039	1.438E-2	1972	0.141	0.124	F1M842.pdb.gz	F1M842_RAT Tumor protein p53 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53bp1 PE=1 SV=3
8	AFDB:Q12888	0.037	0.034	2.073E-2	1972	0.131	0.115	Q12888.pdb.gz	TP53B_HUMAN TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2
9	AFDB:Q70HU3	0.027	0.036	3.320E-2	1135	0.088	0.135	Q70HU3.pdb.gz	Q70HU3_DROME PNUTSDm protein OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=2 SV=1
10	AFDB:A0A1D8PD43	0.030	0.031	3.498E-2	1655	0.135	0.142	A0A1D8PD43.pdb.gz	A0A1D8PD43_CANAL Bni4p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BNI4 PE=4 SV=1
11	PDB:6f2rA	0.027	0.163	5.945E-1	130	0.005	0.062	6f2rA.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
12	PDB:6iegA	0.030	0.053	6.955E-1	872	0.014	0.029	6iegA.pdb.gz	NRDE2 negatively regulates exosome functions by inhibiting MTR4 recruitment and exosome interaction.
13	PDB:3kffA	0.028	0.144	1.446	152	0.006	0.072	3kffA.pdb.gz	High resolution X-ray structures of mouse major urinary protein nasal isoform in complex with pheromones.
14	PDB:2l74A	0.028	0.192	1.524	125	0.007	0.096	2l74A.pdb.gz	Solution structure of the PilZ domain protein PA4608 complex with cyclic di-GMP identifies charge clustering as molecular readout
15	PDB:5m1iA	0.017	0.051	1.524	539	0.003	0.011	5m1iA.pdb.gz	Structural Snapshots for Mechanism-Based Inactivation of a Glycoside Hydrolase by Cyclopropyl Carbasugars.
16	PDB:7wooC	0.024	0.030	1.692	1325	0.006	0.008	7wooC.pdb.gz
17	PDB:2l9cA	0.032	0.172	2.085	176	0.006	0.062	2l9cA.pdb.gz
18	PDB:6r1gA	0.018	0.166	2.085	148	0.005	0.061	6r1gA.pdb.gz	Structural analysis of Borrelia burgdorferi periplasmic lipoprotein BB0365 involved in Lyme disease infection.
19	PDB:3tgoD	0.033	0.116	2.315	186	0.008	0.075	3tgoD.pdb.gz
20	PDB:4ryvA	0.016	0.114	2.315	155	0.005	0.058	4ryvA.pdb.gz	Crystallographic and CD probing of ligand-induced conformational changes in a plant PR-10 protein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5EE70	0.001	46.2	972	0.009	0.016	G5EE70_CAEEL EOR-2 OS=Caenorhabditis elegans OX=6239 GN=eor-2 PE=1 SV=1
2	G5EGD8	0.001	46.2	957	0.009	0.017	G5EGD8_CAEEL EOR-2 OS=Caenorhabditis elegans OX=6239 GN=eor-2 PE=1 SV=1
3	O80739	2.0	35.8	827	0.017	0.036	POT12_ARATH Putative potassium transporter 12 OS=Arabidopsis thaliana OX=3702 GN=POT12 PE=1 SV=2
4	A0A0B4KI44	7.1	33.9	1433	0.011	0.013	A0A0B4KI44_DROME Tusp, isoform F OS=Drosophila melanogaster OX=7227 GN=Tusp PE=3 SV=1
5	P27732	9.8	33.5	2203	0.019	0.015	CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus OX=10116 GN=Cacna1d PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13926 DUF4211	1.1e-19	82.4	Domain of unknown function (DUF4211)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382241

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266712	0.790	Transmembrane and TPR repeat-containing protein 3
2	9606.ENSP00000257836	0.780	Transmembrane gamma-carboxyglutamic acid protein 4
3	9606.ENSP00000324587	0.756	Protein FAM193A
4	9606.ENSP00000331845	0.735	Protein PRR14L
5	9606.ENSP00000335595	0.641	T-complex protein 11-like protein 1
6	9606.ENSP00000261537	0.609	E3 ubiquitin-protein ligase MIB1
7	9606.ENSP00000335325	0.608	Coiled-coil domain containing 73
8	9606.ENSP00000358242	0.580	Arginine/serine-rich protein PNISR
9	9606.ENSP00000363228	0.576	RNA-binding protein 12
10	9606.ENSP00000283233	0.550	Coiled-coil domain containing 148
11	9606.ENSP00000478257	0.545	Cyclin-I2
12	9606.ENSP00000330753	0.527	Bromodomain and WD repeat-containing protein 1
13	9606.ENSP00000241051	0.522	DEP domain containing 7
14	9606.ENSP00000435010	0.518	Beta-defensin 134
15	9606.ENSP00000410734	0.512	Zinc finger protein 562
16	9606.ENSP00000347486	0.508	MORN repeat containing 3
17	9606.ENSP00000217195	0.504	UPF0687 protein C20orf27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050789	0.993	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0009987	0.975	cellular process
GO:0019222	0.870	regulation of metabolic process
GO:0048518	0.742	positive regulation of biological process
GO:0060255	0.726	regulation of macromolecule metabolic process
GO:0010468	0.675	regulation of gene expression
GO:0080090	0.538	regulation of primary metabolic process
GO:0051171	0.500	regulation of nitrogen compound metabolic process
GO:0008152	0.491	metabolic process
GO:0048519	0.418	negative regulation of biological process
GO:0071704	0.412	organic substance metabolic process
GO:0006807	0.382	nitrogen compound metabolic process
GO:0048523	0.332	negative regulation of cellular process
GO:0044237	0.309	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.982	nucleoplasm
GO:0043228	0.855	non-membrane-bounded organelle
GO:0043232	0.679	intracellular non-membrane-bounded organelle
GO:0005737	0.637	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]