StarFunc result for job id Q2KHT3

User Input

>input (1053 residues)
MFGRSRSWVGGGHGKTSRNIHSLDHLKYLYHVLTKNTTVTEQNRNLLVETIRSITEILIW
GDQNDSSVFDFFLEKNMFVFFLNILRQKSGRYVCVQLLQTLNILFENISHETSLYYLLSN
NYVNSIIVHKFDFSDEEIMAYYISFLKTLSLKLNNHTVHFFYNEHTNDFALYTEAIKFFN
HPESMVRIAVRTITLNVYKVSLDNQAMLHYIRDKTAVPYFSNLVWFIGSHVIELDDCVQT
DEEHRNRGKLSDLVAEHLDHLHYLNDILIINCEFLNDVLTDHLLNRLFLPLYVYSLENQD
KGGERPKISLPVSLYLLSQVFLIIHHAPLVNSLAEVILNGDLSEMYAKTEQDIQRSSAKP
SIRCFIKPTETLERSLEMNKHKGKRRVQKRPNYKNVGEEEDEEKGPTEDAQEDAEKAKGT
EGGSKGIKTSGESEEIEMVIMERSKLSELAASTSVQEQNTTDEEKSAAATCSESTQWSRP
FLDMVYHALDSPDDDYHALFVLCLLYAMSHNKGMDPEKLERIQLPVPNAAEKTTYNHPLA
ERLIRIMNNAAQPDGKIRLATLELSCLLLKQQVLMSAGCIMKDVHLACLEGAREESVHLV
RHFYKGEDIFLDMFEDEYRSMTMKPMNVEYLMMDASILLPPTGTPLTGIDFVKRLPCGDV
EKTRRAIRVFFMLRSLSLQLRGEPETQLPLTREEDLIKTDDVLDLNNSDLIACTVITKDG
GMVQRFLAVDIYQMSLVEPDVSRLGWGVVKFAGLLQDMQVTGVEDDSRALNITIHKPASS
PHSKPFPILQATFIFSDHIRCIIAKQRLAKGRIQARRMKMQRIAALLDLPIQPTTEVLGF
GLGSSTSTQHLPFRFYDQGRRGSSDPTVQRSVFASVDKVPGFAVAQCINQHSSPSLSSQS
PPSASGSPSGSGSTSHCDSGGTSSSSTPSTAQSPADAPMSPELPKPHLPDQLVIVNETEA
DSKPSKNVARSAAVETASLSPSLVPARQPTISLLCEDTADTLSVESLTLVPPVDPHSLRS
LTGMPPLSTPAAACTEPVGEEAACAEPVGTAED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2KHT3	1.000	1.000	0.000	1053	1.000	1.000	Q2KHT3.pdb.gz	CL16A_HUMAN Protein CLEC16A OS=Homo sapiens OX=9606 GN=CLEC16A PE=1 SV=2
2	AFDB:Q9VEV4	0.646	0.638	4.283E-70	1067	0.467	0.461	Q9VEV4.pdb.gz	CL16A_DROME Protein CLEC16A homolog OS=Drosophila melanogaster OX=7227 GN=ema PE=1 SV=2
3	AFDB:A0A0G2L933	0.121	0.116	4.045E-7	1110	0.108	0.103	A0A0G2L933.pdb.gz	A0A0G2L933_DANRE Pleckstrin homology domain-containing family G member 5-like isoform X1 OS=Danio rerio OX=7955 GN=plekhg5b PE=4 SV=2
4	AFDB:P59764	0.181	0.109	4.278E-5	1978	0.139	0.074	P59764.pdb.gz	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
5	AFDB:A0A0R4IUA6	0.130	0.095	7.403E-5	1840	0.132	0.076	A0A0R4IUA6.pdb.gz
6	AFDB:F4J8G7	0.226	0.127	1.185E-4	2138	0.130	0.064	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
7	AFDB:Q498H0	0.113	0.093	1.185E-4	1448	0.121	0.088	Q498H0.pdb.gz	PD5BA_XENLA Sister chromatid cohesion protein PDS5 homolog B-A OS=Xenopus laevis OX=8355 GN=pds5b-a PE=1 SV=1
8	AFDB:A0A096MKF8	0.090	0.057	2.696E-4	2190	0.143	0.069	A0A096MKF8.pdb.gz	A0A096MKF8_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=1
9	PDB:6u3eA	0.091	0.207	3.484E-4	397	0.036	0.096	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
10	AFDB:Q9XZ34	0.144	0.121	3.989E-4	1416	0.128	0.095	Q9XZ34.pdb.gz	RIF1_DROME Telomere-associated protein RIF1 OS=Drosophila melanogaster OX=7227 GN=Rif1 PE=1 SV=1
11	AFDB:Q9VXY2	0.071	0.046	4.149E-4	2084	0.109	0.055	Q9VXY2.pdb.gz	MADD_DROME MAP kinase-activating death domain protein OS=Drosophila melanogaster OX=7227 GN=Rab3-GEF PE=2 SV=2
12	PDB:7mp5A	0.127	0.091	5.155E-4	1629	0.105	0.068	7mp5A.pdb.gz
13	PDB:7t3rA	0.099	0.058	8.577E-4	2130	0.097	0.048	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
14	PDB:7cunD	0.133	0.162	2.112E-3	827	0.083	0.105	7cunD.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
15	PDB:3w3uA	0.153	0.155	2.568E-3	1030	0.094	0.096	3w3uA.pdb.gz
16	PDB:2z6gA	0.151	0.253	2.671E-3	550	0.067	0.129	2z6gA.pdb.gz
17	PDB:4mt6A	0.093	0.235	2.671E-3	389	0.037	0.100	4mt6A.pdb.gz
18	PDB:5tbkA	0.104	0.200	3.124E-3	417	0.047	0.118	5tbkA.pdb.gz
19	PDB:7rroH7	0.138	0.223	4.622E-3	580	0.069	0.126	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:1b3uA	0.152	0.246	4.999E-3	588	0.078	0.139	1b3uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KH88	0.0	797	1028	0.430	0.441	A0A0B4KH88_DROME Endosomal maturation defective, isoform C OS=Drosophila melanogaster OX=7227 GN=ema PE=3 SV=1
2	Q2KHT3	0.0	2189	1053	1.000	1.000	CL16A_HUMAN Protein CLEC16A OS=Homo sapiens OX=9606 GN=CLEC16A PE=1 SV=2
3	Q80U30	0.0	1845	1036	0.896	0.910	CL16A_MOUSE Protein CLEC16A OS=Mus musculus OX=10090 GN=Clec16a PE=1 SV=2
4	Q9VEV4	0.0	831	1067	0.442	0.436	CL16A_DROME Protein CLEC16A homolog OS=Drosophila melanogaster OX=7227 GN=ema PE=1 SV=2
5	Q8W4P9	4.17e-49	190	837	0.102	0.128	TT9_ARATH Protein TRANSPARENT TESTA 9 OS=Arabidopsis thaliana OX=3702 GN=TT9 PE=2 SV=1
6	Q38DZ2	1.59e-20	100	821	0.065	0.083	Q38DZ2_TRYB2 FPL domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1630 PE=4 SV=1
7	F1LNJ1	0.57	37.0	2526	0.033	0.014	F1LNJ1_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Lrrk2 PE=1 SV=3
8	A0A8I6GFN0	0.61	36.6	2477	0.033	0.014	A0A8I6GFN0_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Lrrk2 PE=4 SV=1
9	Q9DBY1	1.1	35.4	612	0.025	0.042	SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus OX=10090 GN=Syvn1 PE=1 SV=3
10	O88809	2.0	34.7	366	0.026	0.074	DCX_MOUSE Neuronal migration protein doublecortin OS=Mus musculus OX=10090 GN=Dcx PE=1 SV=1
11	Q86TM6	4.5	33.5	617	0.024	0.041	SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1 PE=1 SV=2
12	Q9ESI7	5.3	33.1	365	0.023	0.066	DCX_RAT Neuronal migration protein doublecortin OS=Rattus norvegicus OX=10116 GN=Dcx PE=1 SV=2
13	Q8RXC3	5.6	33.5	666	0.032	0.051	Q8RXC3_ARATH Aminotransferase-like, plant mobile domain family protein OS=Arabidopsis thaliana OX=3702 GN=DL4065W PE=2 SV=1
14	O43602	6.2	33.1	365	0.023	0.066	DCX_HUMAN Neuronal migration protein doublecortin OS=Homo sapiens OX=9606 GN=DCX PE=1 SV=4
15	Q8BPQ7	7.8	33.1	1093	0.031	0.030	SGSM1_MOUSE Small G protein signaling modulator 1 OS=Mus musculus OX=10090 GN=Sgsm1 PE=1 SV=2
16	Q9W1I8	9.1	32.3	284	0.015	0.056	Q9W1I8_DROME LD03592p OS=Drosophila melanogaster OX=7227 GN=Snap29 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19439 CLEC16A_C	0	1507.7	CLEC16A C-terminal
2	PF19632 DUF6136	2e+02	12.6	Family of unknown function (DUF6136)
3	PF09758 FPL	5.6e-53	190.4	Uncharacterised conserved protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387122

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342755	0.893	E3 ubiquitin-protein ligase NRDP1
2	9606.ENSP00000330509	0.813	Dexamethasone-induced protein
3	9606.ENSP00000326063	0.807	Transmembrane protein 39A
4	9606.ENSP00000356814	0.698	DDB1- and CUL4-associated factor 6
5	9606.ENSP00000310356	0.691	RecQ-mediated genome instability protein 2
6	9606.ENSP00000381567	0.691	TATA element modulatory factor
7	9606.ENSP00000352833	0.687	Tyrosine-protein phosphatase non-receptor type 22
8	9606.ENSP00000345492	0.665	SH2B adapter protein 3
9	9606.ENSP00000320924	0.657	WAS/WASL-interacting protein family member 2
10	9606.ENSP00000373206	0.650	EGF domain-specific O-linked N-acetylglucosamine transferase
11	9606.ENSP00000283027	0.643	Cytosolic Fe-S cluster assembly factor NUBP1
12	9606.ENSP00000311857	0.639	Tyrosine-protein phosphatase non-receptor type 2
13	9606.ENSP00000378320	0.639	Tetratricopeptide repeat protein 7A
14	9606.ENSP00000317971	0.633	WD and tetratricopeptide repeats protein 1
15	9606.ENSP00000369293	0.633	Interleukin-2 receptor subunit alpha
16	9606.ENSP00000369810	0.632	Vacuolar protein sorting-associated protein 16 homolog
17	9606.ENSP00000327323	0.629	Threonine synthase-like 2
18	9606.ENSP00000349732	0.625	Uncharacterized protein C3orf18
19	9606.ENSP00000263642	0.614	Interferon-induced helicase C domain-containing protein 1
20	9606.ENSP00000386651	0.608	Multiple coagulation factor deficiency protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0031267	0.900	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0031329	0.986	regulation of cellular catabolic process
GO:0043244	0.971	regulation of protein-containing complex disassembly
GO:0048519	0.970	negative regulation of biological process
GO:0010506	0.970	regulation of autophagy
GO:0050896	0.961	response to stimulus
GO:0048518	0.950	positive regulation of biological process
GO:0031330	0.948	negative regulation of cellular catabolic process
GO:0016242	0.941	negative regulation of macroautophagy
GO:0048583	0.936	regulation of response to stimulus
GO:0007154	0.935	cell communication
GO:0048522	0.932	positive regulation of cellular process
GO:0023051	0.919	regulation of signaling
GO:0010646	0.919	regulation of cell communication
GO:0009966	0.913	regulation of signal transduction
GO:0051716	0.906	cellular response to stimulus
GO:0033043	0.898	regulation of organelle organization
GO:0007165	0.876	signal transduction
GO:0048584	0.742	positive regulation of response to stimulus
GO:0009605	0.680	response to external stimulus
GO:0006950	0.670	response to stress
GO:1902531	0.616	regulation of intracellular signal transduction
GO:0032006	0.600	regulation of TOR signaling
GO:0060255	0.553	regulation of macromolecule metabolic process
GO:0008152	0.496	metabolic process
GO:0009893	0.468	positive regulation of metabolic process
GO:0009967	0.464	positive regulation of signal transduction
GO:0080090	0.462	regulation of primary metabolic process
GO:0051171	0.462	regulation of nitrogen compound metabolic process
GO:0071496	0.459	cellular response to external stimulus
GO:0071704	0.439	organic substance metabolic process
GO:1903432	0.426	regulation of TORC1 signaling
GO:0051129	0.422	negative regulation of cellular component organization
GO:0044238	0.360	primary metabolic process
GO:0044237	0.350	cellular metabolic process
GO:1902533	0.339	positive regulation of intracellular signal transduction
GO:0032008	0.330	positive regulation of TOR signaling
GO:0042594	0.315	response to starvation
GO:0031669	0.315	cellular response to nutrient levels
GO:0031929	0.312	TOR signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0031982	0.999	vesicle
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.993	cytosol
GO:0016020	0.980	membrane
GO:0031090	0.725	organelle membrane
GO:0097708	0.722	intracellular vesicle
GO:0031410	0.674	cytoplasmic vesicle
GO:0005794	0.664	Golgi apparatus
GO:0005768	0.601	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]