StarFunc result for job id Q2LD37

User Input

>input (1400 residues)
MDQRKNESIVPSITQLEDFLTEHNSNVVWLLVATILSCGWIIYLTYYNSRNVGLILTLVL
NRLYKHGYIHIGSFSFSVLSGKVMVREIYYITEDMSIRIQDGFIIFRWWKMYNPKQKQHD
PKAETRLYITVNDFEFHVYNRSDLYGRLQELFGLEPTIIPPKKDDDKTREIGRTRTQSKI
ERVKVKTESQDPTSSWRSLIPVIKVNVSTGRLAFGNHYQPQTLCINFDDAFLTYTTKPPS
SHLDQFMHIVKGKLENVRVMLVPSPRYVGLQNDEPPRLMGEGFVVMQSNDVDIYYYMDEP
GLVPEETEENIEGEMSSEDCKLQDLPPCWGLDIVCGKGTDFNYGPWADRQRDCLWKFFFP
PDYQVLKVSEIAQPGRPRQILAFELRMNIIADATIDLLFTKNRETNAVHVNVGAGSYLEI
NIPMTVEENGYTPAIKGQLLHVDATTSMQYRTLLEAEMLAFHINASYPRIWNMPQTWQCE
LEVYKATYHFIFAQKNFFTDLIQDWSSDSPPDIFSFVPYTWNFKIMFHQFEMIWAANQHN
WIDCSTKQQENVYLAACGETLNIDFSLPFTDFVPATCNTKFSLRGEDVDLHLFLPDCHPS
KYSLFMLVKNCHPNKMIHDTGIPAECQSGQKTVKPKWRNVTQEKSGWVECWTVPSVMLTI
DYTWHPIYPQKADEQLKQSLSEMEETMLSVLRPSQKTSDRVVSSPSTSSRPPIDPSELPP
DKLHVEMELSPDSQITLYGPLLNAFLCIKENYFGEDDMYMDFEEVISSPVLSLSTSSSSG
WTAVGMENDKKENEGSAKSIHPLALRPWDITVLVNLYKVHGRLPVHGTTDGPECPTAFLE
RLCFEMKKGFRETMLQLILSPLNVFVSDNYQQRPPVDEVLREGHINLSGLQLRAHAMFSA
EGLPLGSDSLEYAWLIDVQAGSLTAKVTAPQLACLLEWGQTFVFHVVCREYELERPKSVI
ICQHGIDRRFCESKLSCIPGPCPTSDDLKYTMIRLAVDGADIYIVEHGCATNIKMGAIRV
ANCNLHNQSVGEGISAAIQDFQVRQYIEQLNNCRIGLQPAVLRRAYWLEAGSANLGLITV
DIALAADHHSKHEAQRHFLETHDARTKRLWFLWPDDILKNKRCRNKCGCLGGCRFFGGTV
TGLDFFKLEELTPSSSSAFSSTSAESDMYYGQSLLQPGEWIITKEIPKIIDGNVNGMKRK
EWENKSVGIEVERKTQHLSLQVPLRSHSSSSSSEENSSSSAAQPLLAGEKESPSSVADDH
LVQKEFLHGTKRDDGQASIPTEISGNSPVSPNTQDKSVGQSPLRSPLKRQASVCSTRLGS
TKSLTAAFYGDKQPVTVGVQFSSDVSRSDENVLDSPKQRRSFGSFPYTPSADSNSFHQYR
SMDSSMSMADSEAYFSAAEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5cslB	0.046	0.035	1.695E-3	2072	0.033	0.022	5cslB.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
2	PDB:6g2iA	0.055	0.044	1.227E-2	2080	0.025	0.017	6g2iA.pdb.gz
3	PDB:5cslA	0.043	0.034	2.065E-2	2050	0.031	0.021	5cslA.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
4	PDB:6a9eA	0.064	0.236	2.974E-2	339	0.011	0.047	6a9eA.pdb.gz
5	PDB:6qk7B	0.040	0.060	4.065E-2	749	0.040	0.075	6qk7B.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
6	PDB:5cskA	0.046	0.037	7.594E-2	1996	0.036	0.026	5cskA.pdb.gz
7	PDB:1po0A	0.057	0.099	9.854E-2	661	0.034	0.071	1po0A.pdb.gz	Structural evidence for iron-free citrate and ferric citrate binding to the TonB-dependent outer membrane transporter FecA
8	PDB:5mxcA	0.039	0.117	1.038E-1	313	0.021	0.093	5mxcA.pdb.gz	Influence of Trp flipping on carbohydrate binding in lectins. An example on Aleuria aurantia lectin AAL.
9	AFDB:P42702	0.037	0.042	1.270E-1	1097	0.081	0.104	P42702.pdb.gz	LIFR_HUMAN Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1
10	PDB:6y0fC	0.038	0.057	1.278E-1	722	0.032	0.062	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
11	PDB:2j1nA	0.045	0.120	1.347E-1	346	0.027	0.110	2j1nA.pdb.gz	Crystal Structure of Osmoporin Ompc from E. Coli at 2.0 A.
12	AFDB:Q0E9F2	0.032	0.030	1.737E-1	1542	0.084	0.077	Q0E9F2.pdb.gz	Q0E9F2_DROME Sticks and stones, isoform B OS=Drosophila melanogaster OX=7227 GN=sns PE=1 SV=1
13	AFDB:A8WH80	0.045	0.054	2.501E-1	1091	0.082	0.105	A8WH80.pdb.gz
14	AFDB:Q559F5	0.042	0.043	2.775E-1	1209	0.079	0.091	Q559F5.pdb.gz	Q559F5_DICDI BCAS3 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272949 PE=4 SV=1
15	AFDB:Q9Y4C0	0.071	0.064	7.466E-1	1643	0.106	0.090	Q9Y4C0.pdb.gz	NRX3A_HUMAN Neurexin-3 OS=Homo sapiens OX=9606 GN=NRXN3 PE=1 SV=4
16	AFDB:P97603	0.040	0.040	9.195E-1	1377	0.087	0.089	P97603.pdb.gz	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
17	AFDB:F1QHL0	0.039	0.048	1.324	1032	0.068	0.092	F1QHL0.pdb.gz
18	AFDB:Q2Q0I9	0.028	0.024	1.548	1779	0.049	0.038	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
19	AFDB:F8VR32	0.039	0.050	1.718	938	0.054	0.081	F8VR32.pdb.gz	F8VR32_HUMAN Neuronal PAS domain protein 3 OS=Homo sapiens OX=9606 GN=NPAS3 PE=1 SV=1
20	AFDB:A0A0A6YWY8	0.021	0.024	1.810	1203	0.044	0.051	A0A0A6YWY8.pdb.gz	A0A0A6YWY8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M9MRK7	0.0	836	5116	0.304	0.083	M9MRK7_DROME Tweek, isoform H OS=Drosophila melanogaster OX=7227 GN=tweek PE=4 SV=1
2	M9MRP6	0.0	836	5095	0.304	0.083	M9MRP6_DROME Tweek, isoform F OS=Drosophila melanogaster OX=7227 GN=tweek PE=4 SV=1
3	M9MRV1	0.0	836	5096	0.304	0.083	M9MRV1_DROME Tweek, isoform G OS=Drosophila melanogaster OX=7227 GN=tweek PE=4 SV=1
4	M9MSI8	0.0	836	5075	0.304	0.084	M9MSI8_DROME Tweek, isoform I OS=Drosophila melanogaster OX=7227 GN=tweek PE=4 SV=1
5	Q2LD37	0.0	2972	5005	1.000	0.280	BLTP1_HUMAN Bridge-like lipid transfer protein family member 1 OS=Homo sapiens OX=9606 GN=BLTP1 PE=1 SV=2
6	X2JA38	0.0	836	5150	0.304	0.083	X2JA38_DROME Tweek, isoform J OS=Drosophila melanogaster OX=7227 GN=tweek PE=4 SV=1
7	X2JAP2	0.0	836	5110	0.304	0.083	X2JAP2_DROME Tweek, isoform K OS=Drosophila melanogaster OX=7227 GN=tweek PE=4 SV=1
8	Q12150	4.15e-15	84.0	2958	0.050	0.024	CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSF1 PE=1 SV=1
9	A0A087X171	3.5	34.3	561	0.017	0.043	A0A087X171_HUMAN Cytoplasmic polyadenylation element-binding protein 1 OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
10	A0A087WXG7	3.9	34.3	588	0.017	0.041	A0A087WXG7_HUMAN Cytoplasmic polyadenylation element binding protein 1 OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
11	Q8LBW3	5.8	32.7	193	0.017	0.124	LBD12_ARATH LOB domain-containing protein 12 OS=Arabidopsis thaliana OX=3702 GN=LBD12 PE=1 SV=2
12	P81408	8.0	33.1	668	0.017	0.036	EREP3_HUMAN Protein ENTREP3 OS=Homo sapiens OX=9606 GN=ENTREP3 PE=1 SV=2
13	Q389A0	9.9	33.1	649	0.026	0.055	Q389A0_TRYB2 Nucleolar complex protein 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1290 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20413 Kiaa1109_N	9.9e-273	918.9	Kiaa1109 N-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264501

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296513	0.822	Adenosine deaminase domain-containing protein 1
2	9606.ENSP00000340648	0.763	E3 ubiquitin-protein ligase HUWE1
3	9606.ENSP00000335153	0.727	Heat shock protein HSP 90-alpha
4	9606.ENSP00000360609	0.727	Heat shock protein HSP 90-beta
5	9606.ENSP00000352925	0.690	Transformation/transcription domain-associated protein
6	9606.ENSP00000478104	0.683	Vacuolar protein sorting 13 homolog D
7	9606.ENSP00000471457	0.652	Unconventional myosin-IXb
8	9606.ENSP00000298910	0.651	Leucine-rich repeat serine/threonine-protein kinase 2
9	9606.ENSP00000368984	0.637	Exosome complex component RRP45
10	9606.ENSP00000311778	0.631	Zinc finger MIZ domain-containing protein 2
11	9606.ENSP00000313670	0.629	ALS2 C-terminal-like protein
12	9606.ENSP00000356033	0.578	T-cell activation Rho GTPase-activating protein
13	9606.ENSP00000416515	0.564	NADPH:adrenodoxin oxidoreductase, mitochondrial
14	9606.ENSP00000335371	0.563	Trafficking protein particle complex subunit 11
15	9606.ENSP00000356429	0.547	Regulator of G-protein signaling 1
16	9606.ENSP00000270747	0.539	Rho guanine nucleotide exchange factor 19
17	9606.ENSP00000345492	0.537	SH2B adapter protein 3
18	9606.ENSP00000246957	0.525	Heat shock protein 75 kDa, mitochondrial
19	9606.ENSP00000336987	0.518	Transmembrane protein 155
20	9606.ENSP00000262903	0.513	E3 ubiquitin-protein ligase HACE1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016192	0.991	vesicle-mediated transport
GO:0016197	0.909	endosomal transport
GO:0006909	0.877	phagocytosis
GO:0098876	0.714	vesicle-mediated transport to the plasma membrane
GO:0032456	0.677	endocytic recycling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0045202	0.907	synapse
GO:0043226	0.882	organelle
GO:0031594	0.861	neuromuscular junction
GO:0005622	0.727	intracellular anatomical structure
GO:0043227	0.584	membrane-bounded organelle
GO:0016020	0.568	membrane
GO:0043229	0.508	intracellular organelle
GO:0012505	0.447	endomembrane system
GO:0005737	0.365	cytoplasm
GO:0043231	0.323	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]