StarFunc result for job id Q2M1K9

User Input

>input (1284 residues)
MHKKRVEEGEASDFSLAWDSSVTAAGGLEGEPECDQKTSRALEDRNSVTSQEERNEDDED
MEDESIYTCDHCQQDFESLADLTDHRAHRCPGDGDDDPQLSWVASSPSSKDVASPTQMIG
DGCDLGLGEEEGGTGLPYPCQFCDKSFIRLSYLKRHEQIHSDKLPFKCTYCSRLFKHKRS
RDRHIKLHTGDKKYHCHECEAAFSRSDHLKIHLKTHSSSKPFKCTVCKRGFSSTSSLQSH
MQAHKKNKEHLAKSEKEAKKDDFMCDYCEDTFSQTEELEKHVLTRHPQLSEKADLQCIHC
PEVFVDENTLLAHIHQAHANQKHKCPMCPEQFSSVEGVYCHLDSHRQPDSSNHSVSPDPV
LGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWTKVVYSCPYCSKRDFN
SLAVLEIHLKTIHADKPQQSHTCQICLDSMPTLYNLNEHVRKLHKNHAYPVMQFGNISAF
HCNYCPEMFADINSLQEHIRVSHCGPNANPSDGNNAFFCNQCSMGFLTESSLTEHIQQAH
CSVGSAKLESPVVQPTQSFMEVYSCPYCTNSPIFGSILKLTKHIKENHKNIPLAHSKKSK
AEQSPVSSDVEVSSPKRQRLSASANSISNGEYPCNQCDLKFSNFESFQTHLKLHLELLLR
KQACPQCKEDFDSQESLLQHLTVHYMTTSTHYVCESCDKQFSSVDDLQKHLLDMHTFVLY
HCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRKEADLQVHVKHSHLGNPAKA
HKCIFCGETFSTEVELQCHITTHSKKYNCKFCSKAFHAIILLEKHLREKHCVFDAATENG
TANGVPPMATKKAEPADLQGMLLKNPEAPNSHEASEDDVDASEPMYGCDICGAAYTMEVL
LQNHRLRDHNIRPGEDDGSRKKAEFIKGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYM
CPICGERFPSLLTLTEHKVTHSKSLDTGTCRICKMPLQSEEEFIEHCQMHPDLRNSLTGF
RCVVCMQTVTSTLELKIHGTFHMQKLAGSSAASSPNGQGLQKLYKCALCLKEFRSKQDLV
KLDVNGLPYGLCAGCMARSANGQVGGLAPPEPADRPCAGLRCPECSVKFESAEDLESHMQ
VDHRDLTPETSGPRKGTQTSPVPRKKTYQCIKCQMTFENEREIQIHVANHMIEEGINHEC
KLCNQMFDSPAKLLCHLIEHSFEGMGGTFKCPVCFTVFVQANKLQQHIFAVHGQEDKIYD
CSQCPQKFFFQTELQNHTMSQHAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08961	0.158	0.155	0.000	1311	0.974	0.953	O08961.pdb.gz	ZN423_RAT Zinc finger protein 423 OS=Rattus norvegicus OX=10116 GN=Znf423 PE=1 SV=2
2	AFDB:Q6KAS7	0.139	0.137	0.000	1311	0.635	0.622	Q6KAS7.pdb.gz	ZN521_MOUSE Zinc finger protein 521 OS=Mus musculus OX=10090 GN=Znf521 PE=1 SV=2
3	AFDB:Q14587	0.057	0.071	1.907E-31	947	0.161	0.219	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
4	AFDB:Q9R164	0.051	0.087	5.505E-22	701	0.120	0.220	Q9R164.pdb.gz	Q9R164_MOUSE Zinc finger protein 111 OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1
5	AFDB:Q9UJW7	0.058	0.076	2.155E-21	825	0.139	0.216	Q9UJW7.pdb.gz	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4
6	AFDB:Q96NL3	0.063	0.110	1.594E-18	588	0.097	0.213	Q96NL3.pdb.gz	ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens OX=9606 GN=ZNF599 PE=1 SV=1
7	AFDB:O75123	0.066	0.123	2.074E-17	536	0.100	0.241	O75123.pdb.gz	ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens OX=9606 GN=ZNF623 PE=1 SV=3
8	AFDB:Q96BV0	0.085	0.164	2.074E-17	537	0.100	0.238	Q96BV0.pdb.gz	ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens OX=9606 GN=ZNF775 PE=1 SV=2
9	AFDB:Q8TF47	0.055	0.092	2.191E-17	636	0.105	0.212	Q8TF47.pdb.gz	ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens OX=9606 GN=ZFP90 PE=1 SV=2
10	AFDB:Q8N393	0.055	0.077	3.210E-17	782	0.124	0.203	Q8N393.pdb.gz	ZN786_HUMAN Zinc finger protein 786 OS=Homo sapiens OX=9606 GN=ZNF786 PE=1 SV=2
11	PDB:3w5kB	0.037	0.227	1.095E-3	110	0.023	0.273	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5dkaA	0.025	0.289	1.575E-1	96	0.017	0.229	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
13	PDB:4kblA	0.031	0.086	1.855E-1	395	0.020	0.066	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
14	PDB:5tteB	0.034	0.082	2.718E-1	442	0.026	0.075	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
15	PDB:1b8tA	0.026	0.096	7.669E-1	192	0.015	0.099	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
16	PDB:7o4iW	0.030	0.087	7.669E-1	312	0.026	0.109	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
17	PDB:5apny	0.033	0.125	9.034E-1	211	0.019	0.114	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:7uhyD	0.035	0.099	1.187	288	0.019	0.083	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:5n5yI	0.016	0.133	1.254	99	0.012	0.162	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
20	PDB:7r7jB	0.024	0.044	1.837	574	0.022	0.049	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5H7S1	0.0	2425	1167	0.909	1.000	F5H7S1_HUMAN Zinc finger protein 423 OS=Homo sapiens OX=9606 GN=ZNF423 PE=1 SV=1
2	J3KTI4	0.0	1352	1091	0.530	0.624	J3KTI4_HUMAN Zinc finger protein 521 OS=Homo sapiens OX=9606 GN=ZNF521 PE=1 SV=1
3	O08961	0.0	2602	1311	0.974	0.954	ZN423_RAT Zinc finger protein 423 OS=Rattus norvegicus OX=10116 GN=Znf423 PE=1 SV=2
4	Q2M1K9	0.0	2671	1284	1.000	1.000	ZN423_HUMAN Zinc finger protein 423 OS=Homo sapiens OX=9606 GN=ZNF423 PE=1 SV=1
5	Q6KAS7	0.0	1630	1311	0.641	0.628	ZN521_MOUSE Zinc finger protein 521 OS=Mus musculus OX=10090 GN=Znf521 PE=1 SV=2
6	Q80TS5	0.0	2622	1292	0.979	0.973	ZN423_MOUSE Zinc finger protein 423 OS=Mus musculus OX=10090 GN=Znf423 PE=1 SV=2
7	Q96K83	0.0	1625	1311	0.636	0.623	ZN521_HUMAN Zinc finger protein 521 OS=Homo sapiens OX=9606 GN=ZNF521 PE=1 SV=1
8	Q05481	4.65e-51	199	1191	0.206	0.222	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
9	A0A0B4JD76	7.02e-49	193	1366	0.129	0.122	A0A0B4JD76_DROME O/E-associated zinc finger protein, isoform C OS=Drosophila melanogaster OX=7227 GN=L PE=4 SV=1
10	A1Z9R4	9.19e-49	192	1228	0.129	0.134	ZN423_DROME Zinc finger protein 423 homolog OS=Drosophila melanogaster OX=7227 GN=Oaz PE=2 SV=2
11	J3QQI2	3.23e-45	163	184	0.069	0.478	J3QQI2_HUMAN Zinc finger protein 521 (Fragment) OS=Homo sapiens OX=9606 GN=ZNF521 PE=1 SV=8
12	A0A1B0GR71	2.24e-37	155	966	0.159	0.211	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
13	Q14587	2.60e-34	145	947	0.143	0.193	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
14	Q9P2J8	9.39e-33	140	865	0.130	0.193	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
15	A0A8I6G8Y2	4.47e-32	137	723	0.124	0.220	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
16	G3V9G6	6.51e-32	136	740	0.124	0.215	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
17	Q62788	8.05e-32	136	744	0.124	0.214	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
18	Q5TYW1	2.43e-31	135	1059	0.127	0.154	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
19	Q7TMN8	2.48e-31	133	578	0.120	0.266	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
20	Q8BLA2	2.81e-31	133	578	0.119	0.265	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	1.1e-53	187.9	Zinc finger, C2H2 type
2	PF12756 zf-C2H2_2	0.12	24.1	C2H2 type zinc-finger (2 copies)
3	PF18868 zf-C2H2_3rep	2	20.5	Zinc finger C2H2-type, 3 repeats
4	PF13894 zf-C2H2_4	2.2e-66	225.7	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	1.3e-21	87.3	C2H2-type zinc finger
6	PF16293 zf-C2H2_9	2.1e+02	13.2	C2H2 type zinc-finger (1 copy)
7	PF12171 zf-C2H2_jaz	1.1e-14	65.5	Zinc-finger double-stranded RNA-binding
8	PF16278 zf-C2HE	64	15.5	C2HE / C2H2 / C2HC zinc-binding finger
9	PF05605 zf-Di19	4.9e-21	86.1	Drought induced 19 protein (Di19), zinc-binding
10	PF13465 zf-H2C2_2	6.5e-19	78.6	Zinc-finger double domain
11	PF12874 zf-met	4.7	19.0	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000455426

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361959	0.978	WNT1-inducible-signaling pathway protein 2
2	9606.ENSP00000341551	0.973	Mothers against decapentaplegic homolog 4
3	9606.ENSP00000333633	0.880	Metastasis-associated protein MTA1
4	9606.ENSP00000322898	0.870	Transcription factor COE1
5	9606.ENSP00000277541	0.822	Neurogenic locus notch homolog protein 1
6	9606.ENSP00000354206	0.817	Zinc finger protein 219
7	9606.ENSP00000471575	0.755	Methyl-CpG-binding domain protein 3-like 1
8	9606.ENSP00000430241	0.742	Transcription factor COE2
9	9606.ENSP00000369424	0.741	Histone-binding protein RBBP7
10	9606.ENSP00000355759	0.733	Poly [ADP-ribose] polymerase 1
11	9606.ENSP00000423630	0.672	F-box/LRR-repeat protein 7
12	9606.ENSP00000448012	0.671	Centrosomal protein of 290 kDa
13	9606.ENSP00000370022	0.667	Transcription factor COE4
14	9606.ENSP00000362170	0.660	Nuclear apoptosis-inducing factor 1
15	9606.ENSP00000426568	0.654	Mothers against decapentaplegic homolog 1
16	9606.ENSP00000355245	0.647	Paired box protein Pax-9
17	9606.ENSP00000287820	0.635	Peroxisome proliferator-activated receptor gamma
18	9606.ENSP00000285873	0.611	Gem-associated protein 5
19	9606.ENSP00000355499	0.558	Serologically defined colon cancer antigen 8
20	9606.ENSP00000419692	0.553	Retinoic acid receptor RXR-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	1.000	sequence-specific DNA binding
GO:0042802	0.875	identical protein binding
GO:0044877	0.854	protein-containing complex binding
GO:1990837	0.643	sequence-specific double-stranded DNA binding
GO:0140110	0.607	transcription regulator activity
GO:0003700	0.530	DNA-binding transcription factor activity
GO:0000981	0.513	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.504	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0009987	0.969	cellular process
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0010468	0.964	regulation of gene expression
GO:0031323	0.958	regulation of cellular metabolic process
GO:0006355	0.945	regulation of DNA-templated transcription
GO:0048519	0.927	negative regulation of biological process
GO:0048523	0.901	negative regulation of cellular process
GO:0009892	0.859	negative regulation of metabolic process
GO:0051172	0.850	negative regulation of nitrogen compound metabolic process
GO:0010605	0.845	negative regulation of macromolecule metabolic process
GO:0031324	0.840	negative regulation of cellular metabolic process
GO:0045892	0.831	negative regulation of DNA-templated transcription
GO:0048518	0.775	positive regulation of biological process
GO:0048522	0.601	positive regulation of cellular process
GO:0010604	0.480	positive regulation of macromolecule metabolic process
GO:0051173	0.465	positive regulation of nitrogen compound metabolic process
GO:0051254	0.459	positive regulation of RNA metabolic process
GO:0032502	0.443	developmental process
GO:1903508	0.435	positive regulation of nucleic acid-templated transcription
GO:0045893	0.434	positive regulation of DNA-templated transcription
GO:0048856	0.427	anatomical structure development
GO:0032501	0.367	multicellular organismal process
GO:0006357	0.353	regulation of transcription by RNA polymerase II
GO:0050896	0.335	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]