StarFunc result for job id Q2M1P5

User Input

>input (1343 residues)
MGLEAQRLPGAEEAPVRVALRVRPLLPKELLHGHQSCLQVEPGLGRVTLGRDRHFGFHVV
LAEDAGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVASLLEDEQGIV
PRAMAEAFKLIDENDLLDCLVHVSYLEVYKEEFRDLLEVGTASRDIQLREDERGNVVLCG
VKEVDVEGLDEVLSLLEMGNAARHTGATHLNHLSSRSHTVFTVTLEQRGRAPSRLPRPAP
GQLLVSKFHFVDLAGSERVLKTGSTGERLKESIQINSSLLALGNVISALGDPQRRGSHIP
YRDSKITRILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQNIRNRATVNWRPE
AERPPEETASGARGPPRHRSETRIIHRGRRAPGPATASAAAAMRLGAECARYRACTDAAY
SLLRELQAEPGLPGAAARKVRDWLCAVEGERSALSSASGPDSGIESASVEDQAAQGAGGR
KEDEGAQQLLTLQNQVARLEEENRDFLAALEDAMEQYKLQSDRLREQQEEMVELRLRLEL
VRPGWGGPRLLNGLPPGSFVPRPHTAPLGGAHAHVLGMVPPACLPGDEVGSEQRGEQVTN
GREAGAELLTEVNRLGSGSSAASEEEEEEEEPPRRTLHLRRNRISNCSQRAGARPGSLPE
RKGPELCLEELDAAIPGSRAVGGSKARVQARQVPPATASEWRLAQAQQKIRELAINIRMK
EELIGELVRTGKAAQALNRQHSQRIRELEQEAEQVRAELSEGQRQLRELEGKELQDAGER
SRLQEFRRRVAAAQSQVQVLKEKKQATERLVSLSAQSEKRLQELERNVQLMRQQQGQLQR
RLREETEQKRRLEAEMSKRQHRVKELELKHEQQQKILKIKTEEIAAFQRKRRSGSNGSVV
SLEQQQKIEEQKKWLDQEMEKVLQQRRALEELGEELHKREAILAKKEALMQEKTGLESKR
LRSSQALNEDIVRVSSRLEHLEKELSEKSGQLRQGSAQSQQQIRGEIDSLRQEKDSLLKQ
RLEIDGKLRQGSLLSPEEERTLFQLDEAIEALDAAIEYKNEAITCRQRVLRASASLLSQC
EMNLMAKLSYLSSSETRALLCKYFDKVVTLREEQHQQQIAFSELEMQLEEQQRLVYWLEV
ALERQRLEMDRQLTLQQKEHEQNMQLLLQQSRDHLGEGLADSRRQYEARIQALEKELGRY
MWINQELKQKLGGVNAVGHSRGGEKRSLCSEGRQAPGNEDELHLAPELLWLSPLTEGAPR
TREETRDLVHAPLPLTWKRSSLCGEEQGSPEELRQREAAEPLVGRVLPVGEAGLPWNFGP
LSKPRRELRRASPGMIDVRKNPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7ZNG0	0.315	0.314	0.000	1348	0.887	0.884	B7ZNG0.pdb.gz	KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus OX=10090 GN=Kif7 PE=1 SV=1
2	AFDB:Q2M1P5	1.000	1.000	0.000	1343	1.000	1.000	Q2M1P5.pdb.gz	KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens OX=9606 GN=KIF7 PE=1 SV=2
3	AFDB:Q58G59	0.326	0.322	0.000	1363	0.580	0.572	Q58G59.pdb.gz	KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio OX=7955 GN=kif7 PE=1 SV=1
4	AFDB:Q86VH2	0.300	0.289	1.304E-86	1401	0.412	0.395	Q86VH2.pdb.gz	KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens OX=9606 GN=KIF27 PE=1 SV=1
5	AFDB:Q7M6Z4	0.262	0.253	1.377E-85	1394	0.398	0.384	Q7M6Z4.pdb.gz	KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus OX=10090 GN=Kif27 PE=1 SV=1
6	AFDB:Q9XZ29	0.245	0.271	5.918E-44	1212	0.212	0.235	Q9XZ29.pdb.gz	Q9XZ29_DROME EG:BACR25B3.9 protein OS=Drosophila melanogaster OX=7227 GN=Klp3A PE=1 SV=1
7	AFDB:O45935	0.243	0.301	1.974E-41	1083	0.198	0.246	O45935.pdb.gz	KLP19_CAEEL Kinesin-like protein klp-19 OS=Caenorhabditis elegans OX=6239 GN=klp-19 PE=2 SV=1
8	AFDB:Q57ZA7	0.250	0.311	7.759E-38	1072	0.179	0.225	Q57ZA7.pdb.gz	Q57ZA7_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.1000 PE=3 SV=1
9	AFDB:Q57UD0	0.244	0.184	8.196E-38	1803	0.207	0.154	Q57UD0.pdb.gz	Q57UD0_TRYB2 Kinesin K39, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.6C8.180 PE=3 SV=1
10	AFDB:Q54NP8	0.242	0.170	2.453E-37	1922	0.184	0.129	Q54NP8.pdb.gz	KIF4_DICDI Kinesin-related protein 4 OS=Dictyostelium discoideum OX=44689 GN=kif4 PE=2 SV=1
11	PDB:7wrgA	0.230	0.375	3.746E-28	812	0.098	0.161	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.224	0.379	4.661E-27	783	0.094	0.161	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.202	0.396	1.319E-24	670	0.074	0.148	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:7n6g3I	0.059	0.150	5.422E-2	401	0.041	0.137	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
15	PDB:3sqbE	0.032	0.129	1.377E-1	176	0.007	0.051	3sqbE.pdb.gz
16	PDB:7a5fs3	0.038	0.085	1.811E-1	370	0.024	0.086	7a5fs3.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
17	PDB:7sqcO1	0.059	0.102	2.658E-1	673	0.038	0.076	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:5j6hA	0.038	0.135	3.495E-1	275	0.007	0.036	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
19	PDB:2zdiB	0.063	0.760	3.692E-1	106	0.013	0.170	2zdiB.pdb.gz
20	PDB:6vijB	0.044	0.171	4.598E-1	191	0.016	0.110	6vijB.pdb.gz	Genetic and structural studies of RABL3 reveal an essential role in lymphoid development and function.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7ZNG0	0.0	2273	1348	0.888	0.884	KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus OX=10090 GN=Kif7 PE=1 SV=1
2	Q2M1P5	0.0	2686	1343	1.000	1.000	KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens OX=9606 GN=KIF7 PE=1 SV=2
3	Q58G59	0.0	1372	1363	0.594	0.585	KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio OX=7955 GN=kif7 PE=1 SV=1
4	Q7M6Z4	0.0	912	1394	0.424	0.408	KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus OX=10090 GN=Kif27 PE=1 SV=1
5	Q86VH2	4.83e-151	495	1401	0.200	0.192	KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens OX=9606 GN=KIF27 PE=1 SV=1
6	Q7Z4S6	1.20e-96	344	1674	0.130	0.105	KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2
7	A0A1B0GV47	1.26e-95	341	1653	0.129	0.105	A0A1B0GV47_HUMAN Kinesin family member 21A (Fragment) OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=1
8	O95239	9.06e-95	334	1232	0.126	0.137	KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A PE=1 SV=3
9	Q2VIQ3	5.43e-94	332	1234	0.127	0.138	KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens OX=9606 GN=KIF4B PE=2 SV=2
10	P33174	1.42e-93	331	1231	0.124	0.136	KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus OX=10090 GN=Kif4 PE=1 SV=3
11	Q9QXL1	6.97e-93	333	1668	0.130	0.105	KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2
12	O75037	1.20e-92	332	1637	0.131	0.108	KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens OX=9606 GN=KIF21B PE=1 SV=2
13	Q6YUL8	3.42e-92	323	1035	0.130	0.169	KN4A_ORYSJ Kinesin-like protein KIN-4A OS=Oryza sativa subsp. japonica OX=39947 GN=KIN4A PE=1 SV=1
14	F4K0J3	7.15e-92	327	1300	0.127	0.132	KN4C_ARATH Kinesin-like protein KIN-4C OS=Arabidopsis thaliana OX=3702 GN=KIN4C PE=2 SV=2
15	A0A068FIK2	1.70e-91	322	1033	0.129	0.167	KN4A_GOSHI Kinesin-like protein KIN-4A OS=Gossypium hirsutum OX=3635 GN=KIN4A PE=2 SV=1
16	Q8GS71	2.58e-91	321	1035	0.124	0.161	KN4A_ARATH Kinesin-like protein KIN-4A OS=Arabidopsis thaliana OX=3702 GN=KIN4A PE=1 SV=1
17	P46873	2.96e-82	287	699	0.117	0.225	OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans OX=6239 GN=osm-3 PE=1 SV=4
18	P46872	1.27e-79	280	699	0.117	0.225	KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP85 PE=1 SV=1
19	E9QB71	1.11e-77	274	701	0.112	0.215	E9QB71_DANRE Kinesin-like protein OS=Danio rerio OX=7955 GN=fc55h04 PE=1 SV=1
20	P46871	2.21e-77	274	742	0.112	0.204	KRP95_STRPU Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP95 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00225 Kinesin	6.3e-101	349.2	Kinesin motor domain
2	PF16796 Microtub_bd	2.9e-12	58.2	Microtubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377934

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228682	0.982	Zinc finger protein GLI1
2	9606.ENSP00000358918	0.980	Suppressor of fused homolog
3	9606.ENSP00000390436	0.966	Zinc finger protein GLI2
4	9606.ENSP00000379258	0.962	Transcriptional activator GLI3
5	9606.ENSP00000249373	0.863	Smoothened homolog
6	9606.ENSP00000301071	0.833	Tubulin alpha-1A chain
7	9606.ENSP00000259818	0.832	Tubulin beta-2B chain
8	9606.ENSP00000332353	0.651	Protein patched homolog 1
9	9606.ENSP00000295709	0.629	Serine/threonine-protein kinase 36
10	9606.ENSP00000389014	0.628	Protein JBTS17
11	9606.ENSP00000377769	0.627	ADP-ribosylation factor-like protein 13B
12	9606.ENSP00000356774	0.625	Jouberin
13	9606.ENSP00000344314	0.615	Oral-facial-digital syndrome 1 protein
14	9606.ENSP00000403465	0.614	Coiled-coil and C2 domain-containing protein 2A
15	9606.ENSP00000278826	0.612	Transmembrane protein 138
16	9606.ENSP00000386264	0.612	Transmembrane protein 237
17	9606.ENSP00000223208	0.609	Centrosomal protein of 41 kDa
18	9606.ENSP00000369257	0.603	Protein fantom
19	9606.ENSP00000389998	0.603	Meckelin
20	9606.ENSP00000440638	0.603	Transmembrane protein 216

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003777	0.998	microtubule motor activity
GO:0042802	0.728	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.982	regulation of cellular process
GO:0032502	0.970	developmental process
GO:0009987	0.965	cellular process
GO:0048856	0.913	anatomical structure development
GO:0032501	0.908	multicellular organismal process
GO:0009966	0.800	regulation of signal transduction
GO:0008589	0.778	regulation of smoothened signaling pathway
GO:0048519	0.749	negative regulation of biological process
GO:0048523	0.739	negative regulation of cellular process
GO:0007275	0.704	multicellular organism development
GO:0071840	0.550	cellular component organization or biogenesis
GO:0016043	0.538	cellular component organization
GO:0048518	0.519	positive regulation of biological process
GO:0048522	0.473	positive regulation of cellular process
GO:0048585	0.355	negative regulation of response to stimulus
GO:0048731	0.301	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	1.000	cilium
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0097542	0.994	ciliary tip
GO:0015630	0.946	microtubule cytoskeleton
GO:0005815	0.892	microtubule organizing center
GO:0005737	0.878	cytoplasm
GO:0005829	0.703	cytosol
GO:0043231	0.671	intracellular membrane-bounded organelle
GO:0036064	0.377	ciliary basal body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]