StarFunc result for job id Q2M1Z3

User Input

>input (1444 residues)
MKNKGAKQKLKRKGAASAFGCDLTEYLESSGQDVPYVLKSCAEFIETHGIVDGIYRLSGV
TSNIQRLRQEFGSDQCPDLTREVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTEAVS
HCPEEGQLARIQNVIQELPPSHYRTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLLR
SKEIEATGCNGDAAFLAVRVQQVVIEFILNHVDQIFNNGAPGSLENDENRPIMKSLTLPA
LSLPMKLVSLEEAQARSLATNHPARKERRENSLPEIVPPMGTLFHTVLELPDNKRKLSSK
SKKWKSIFNLGRSGSDSKSKLSRNGSVFVRGQRLSVEKATIRPAKSMDSLCSVPVEGKET
KGNFNRTVTTGGFFIPATKMHSTGTGSSCDLTKQEGEWGQEGMPPGAEGGFDVSSDRSHL
QGAQARPPPEQLKVFRPVEDPESEQTAPKMLGMFYTSNDSPSKSVFTSSLFQMEPSPRNQ
RKALNISEPFAVSVPLRVSAVISTNSTPCRTPPKELQSLSSLEEFSFHGSESGGWPEEEK
PLGAETSAASVPKKAGLEDAKAVPEAPGTVECSKGLSQEPGAHLEEKKTPESSLSSQHLN
ELEKRPNPEKVVEEGREAGEMESSTLQESPRARAEAVLLHEMDEDDLANALIWPEIQQEL
KIIESEEELSSLPPPALKTSPIQPILESSLGPFIPSEPPGSLPCGSFPAPVSTPLEVWTR
DPANQSTQGASTAASREKPEPEQGLHPDLASLAPLEIVPFEKASPQATVEVGGPGNLSPP
LPPAPPPPTPLEESTPVLLSKGGPEREDSSRKLRTDLYIDQLKSQDSPEISSLCQGEEAT
PRHSDKQNSKNAASEGKGCGFPSPTREVEIVSQEEEDVTHSVQEPSDCDEDDTVTDIAQH
GLEMVEPWEEPQWVTSPLHSPTLKDAHKAQVQGLQGHQLEKRLSHRPSLRQSHSLDSKPT
VKSQWTLEVPSSSSCANLETERNSDPLQPQAPRREITGWDEKALRSFREFSGLKGAEAPP
NQKGPSGVQPNPAETSPISLAEGKELGTHLGHSSPQIRQGGVPGPESSKESSPSVQDSTS
PGEHPAKLQLKSTECGPPKGKNRPSSLNLDPAIPIADLFWFENVASFSSPGMQVSEPGDP
KVTWMTSSYCKADPWRVYSQDPQDLDIVAHALTGRRNSAPVSVSAVRTSFMVKMCQARAV
PVIPPKIQYTQIPQPLPSQSSGENGVQPLERSQEGPSSTSGTTQKPAKDDSPSSLESSKE
EKPKQDPGAIKSSPVDATAPCMCEGPTLSPEPGSSNLLSTQDAVVQCRKRMSETEPSGDN
LLSSKLERPSGGSKPFHRSRPGRPQSLILFSPPFPIMDHLPPSSTVTDSKVLLSPIRSPT
QTVSPGLLCGELAENTWVTPEGVTLRNKMTIPKNGQRLETSTSCFYQPQRRSVILDGRSG
RQIE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6X8Z5	0.265	0.268	0.000	1425	0.778	0.788	A6X8Z5.pdb.gz	RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus OX=10090 GN=Arhgap31 PE=1 SV=1
2	AFDB:Q2M1Z3	1.000	1.000	0.000	1444	1.000	1.000	Q2M1Z3.pdb.gz	RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2
3	AFDB:Q7Z6I6	0.171	0.218	2.865E-32	1101	0.231	0.303	Q7Z6I6.pdb.gz	RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=3
4	AFDB:A7KAX9	0.142	0.101	6.165E-32	2087	0.264	0.183	A7KAX9.pdb.gz	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
5	AFDB:D4A9G6	0.148	0.162	1.126E-31	1310	0.204	0.224	D4A9G6.pdb.gz	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
6	AFDB:F1MAK3	0.153	0.108	3.185E-31	2101	0.266	0.183	F1MAK3.pdb.gz	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
7	AFDB:A0A0A0MRJ9	0.157	0.249	3.364E-31	890	0.211	0.342	A0A0A0MRJ9.pdb.gz	A0A0A0MRJ9_HUMAN Rho GTPase activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=1
8	AFDB:Q9VIS1	0.143	0.113	2.633E-24	1843	0.208	0.163	Q9VIS1.pdb.gz	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
9	PDB:3cxlA	0.134	0.473	2.659E-15	402	0.046	0.167	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
10	PDB:6r3vA	0.129	0.898	1.301E-14	198	0.037	0.268	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
11	PDB:1xa6A	0.132	0.469	3.122E-14	399	0.043	0.155	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
12	AFDB:Q6P4F7	0.122	0.169	4.598E-12	1023	0.132	0.187	Q6P4F7.pdb.gz	RHGBA_HUMAN Rho GTPase-activating protein 11A OS=Homo sapiens OX=9606 GN=ARHGAP11A PE=1 SV=2
13	PDB:5jcpA	0.112	0.432	4.529E-11	361	0.035	0.139	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
14	PDB:5c2kA	0.124	0.453	5.955E-11	382	0.038	0.144	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
15	AFDB:Q965S4	0.114	0.145	2.630E-9	1126	0.133	0.171	Q965S4.pdb.gz	Q965S4_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rga-4 PE=1 SV=3
16	PDB:6swy8	0.041	0.105	1.460E-1	325	0.026	0.114	6swy8.pdb.gz
17	PDB:5mrc88	0.042	0.095	5.143E-1	452	0.021	0.069	5mrc88.pdb.gz	The structure of the yeast mitochondrial ribosome.
18	PDB:3riuC	0.048	0.184	5.432E-1	190	0.016	0.121	3riuC.pdb.gz
19	PDB:6jmqA	0.039	0.087	6.401E-1	403	0.026	0.094	6jmqA.pdb.gz	Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.
20	PDB:4abnB	0.042	0.095	7.142E-1	426	0.025	0.085	4abnB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6X8Z5	0.0	2094	1425	0.779	0.789	RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus OX=10090 GN=Arhgap31 PE=1 SV=1
2	Q2M1Z3	0.0	2928	1444	1.000	1.000	RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2
3	A0A0A0MRJ9	4.65e-109	369	890	0.135	0.219	A0A0A0MRJ9_HUMAN Rho GTPase activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=1
4	Q7Z6I6	2.92e-108	372	1101	0.135	0.177	RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=3
5	A0A8I5Y6H2	3.52e-103	367	2046	0.134	0.095	A0A8I5Y6H2_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
6	F1MAK3	4.68e-103	367	2101	0.134	0.092	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
7	A0A8I6GIC6	4.77e-103	367	2061	0.134	0.094	A0A8I6GIC6_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
8	A7KAX9	8.28e-103	366	2087	0.136	0.094	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
9	Q811P8	3.25e-102	364	2089	0.134	0.093	RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus OX=10090 GN=Arhgap32 PE=1 SV=2
10	A1A5D2	9.29e-90	311	748	0.105	0.202	A1A5D2_HUMAN SNX26 protein OS=Homo sapiens OX=9606 GN=SNX26 PE=1 SV=1
11	O14559	2.37e-87	314	1287	0.118	0.132	RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens OX=9606 GN=ARHGAP33 PE=1 SV=2
12	Q80YF9	1.88e-86	311	1305	0.113	0.125	RHG33_MOUSE Rho GTPase-activating protein 33 OS=Mus musculus OX=10090 GN=Arhgap33 PE=1 SV=1
13	D4A9G6	3.27e-86	311	1354	0.113	0.120	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
14	A0A8I6AJS5	3.43e-86	311	1309	0.103	0.114	A0A8I6AJS5_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=3 SV=1
15	A0A8I6GFW8	1.58e-78	290	2070	0.116	0.081	A0A8I6GFW8_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
16	Q9VIS1	1.02e-59	229	1843	0.075	0.059	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
17	Q20498	1.67e-34	145	759	0.055	0.104	RRC1_CAEEL GTPase-activating protein rrc-1 OS=Caenorhabditis elegans OX=6239 GN=rrc-1 PE=1 SV=3
18	P30337	5.95e-29	121	334	0.047	0.204	CHIN_RAT N-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn1 PE=1 SV=2
19	P15882	6.20e-29	124	459	0.048	0.150	CHIN_HUMAN N-chimaerin OS=Homo sapiens OX=9606 GN=CHN1 PE=1 SV=3
20	Q03070	7.68e-29	120	295	0.045	0.220	CHIO_RAT Beta-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00620 RhoGAP	1.3e-40	150.1	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264245

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000454157	0.957	Zinc finger E-box-binding homeobox 2
2	9606.ENSP00000370719	0.819	Intersectin-1
3	9606.ENSP00000240874	0.816	Kalirin
4	9606.ENSP00000353452	0.738	Myosin light chain kinase, smooth muscle
5	9606.ENSP00000294618	0.732	Dedicator of cytokinesis protein 6
6	9606.ENSP00000373206	0.687	EGF domain-specific O-linked N-acetylglucosamine transferase
7	9606.ENSP00000383118	0.684	Cell division control protein 42 homolog
8	9606.ENSP00000334008	0.671	Alpha-parvin
9	9606.ENSP00000326063	0.659	Transmembrane protein 39A
10	9606.ENSP00000361857	0.613	Zinc finger protein Rlf
11	9606.ENSP00000428968	0.580	E3 ubiquitin-protein ligase RNF19A
12	9606.ENSP00000222330	0.571	Glycogen synthase kinase-3 alpha
13	9606.ENSP00000347244	0.565	Intersectin-2
14	9606.ENSP00000348461	0.527	Ras-related C3 botulinum toxin substrate 1
15	9606.ENSP00000392065	0.517	RalBP1-associated Eps domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0023051	0.985	regulation of signaling
GO:0010646	0.985	regulation of cell communication
GO:0048583	0.965	regulation of response to stimulus
GO:0009966	0.917	regulation of signal transduction
GO:0009987	0.906	cellular process
GO:1902531	0.872	regulation of intracellular signal transduction
GO:0051056	0.764	regulation of small GTPase mediated signal transduction
GO:0050896	0.702	response to stimulus
GO:0051716	0.562	cellular response to stimulus
GO:0023052	0.548	signaling
GO:0007154	0.548	cell communication
GO:0007165	0.540	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.993	cytosol
GO:0043226	0.800	organelle
GO:0043229	0.761	intracellular organelle
GO:0043231	0.740	intracellular membrane-bounded organelle
GO:0042995	0.333	cell projection
GO:0031252	0.318	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]