StarFunc result for job id Q2M2H8

User Input

>input (2515 residues)
MARKLSVLEVLLIIFCLIVVTIDILLLLLVLEETSDTSFTPECPEIPQSERIDCTPDQEV
TEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGN
DVATTLFTAEYQTSNRFHFKITDFNNIRYEVSHENINLVDGIADASNLSYYVEVTDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDARGSSFGVFLMNSNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFFPPYWSLGFQLSRRDYGGINKLKEVVSRNRLAEI
PYDVQYSDIDYMDGKKDFTVDEVAYSGLPDFVKELHDNGQKYLIIMNPGISKNSNYEPYN
NGSLKRVWILGSNGFAVGEGYPGPTVFPDYTNPVCTEWWTDQVAKFHDHLEFDGVWIEMN
EVSSLLQASNNQCESNNLNFPPFLPRVLDHLLFARTLCMDTEFHGGLHYDIHSLYGHSMA
RTTNLALETIFMNNRSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPTILEFNLFGI
PMVGANICGYNNNVTEELCRRWMQLGAFYPLPRNHNGPGFRDQDPAAFGVDSLLLKSSRH
YLNIRYTLLPYLYTLFYHAHTRGETVARPLVHEFYQDSATWDVHEQFLWGPGLLITPVLY
EGVDEVKAYIPDATWYDYETGVAISWRKQLVNMLLPGDKIGLHLRGGYIFPTQKPNTTTE
ASRRNSLGLIIALDYKREAKGELYWDDGVSKDAVTEKKYILYDFSVTSNHLQAKIINNNY
MDTDNLMFTDITILGMDKQPANFIVLLNNVATSSPSVVYNASTKVVTITDLQGLVLGQEF
SIRWNLPVSDLEKFNCYPDDPTASEESCRQRGCLWEDTSTPGVPTCYYDTIPNYVASDIQ
YLNTSITADLSLPMAPESAAAAASDSLSAKISFLHLKVIYHTATMLQVKIYDPTNKRYEV
PVPLNTPPQPVGDPENRLYDVRIQNNPFGIQIQRKNSSTVIWDSQLPGFIFNDMFLSIST
RLPSQYIYGFGETEHTTFRRNMNWNTWGMFAHDEPPAYKKNSYGVHPYYMALEEDGSAHG
VLLLNSNAMDVTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRPAMIPYWAL
GFHLSRYGYQNDAEISSLYDAMVAAQIPYDVQHVDIDYMNRKLDFTLSANFQNLSLLIEQ
MKKNGMRFILILDPAISGNETQYLPFIRGQENNVFIKWPDTNDIVWGKVWPDLPNVIVDG
SLDHETQVKLYRAYVAFPDFFRNSTAAWWKKEIEELYANPREPEKSLKFDGLWIDMNEPS
NFVDGSVRGCSNEMLNNPPYMPYLESRDKGLSSKTLCMESQQILPDSSPVEHYNVHNLYG
WSQTRPTYEAVQEVTGQRGVIITRSTFPSSGRWGGHRLGNNTAAWDQLGKSIIGMMEFSL
FGIPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGTRRQDPVAWNSTFEMLSR
KVLETRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTDDRTTWDIDRQFMLGPAILISPVL
ETSTFEISAYFPRARWYDYSTGTSSTSTGQRKILKAPLDHINLHVRGGYILPWQEPAMNT
HSSRQNFMGLIVALDDNGTAEGQVFWDDGQSIDTYENGNYFLANFIAAQNILQIQTIHNK
YLSDSNPLKVGYIRIWGVNTYVTQVSFTYDNRQFMETNFKSEPYNQILTIQLTDKTINLE
KLTEVTWIDGGPVLPTPTKTSTIPMSSHPSPSTTNATSSETITSSASANTTTGTTDTVPI
TTTSFPSTTSVTTNTTVPDTTSPFPTSTTNASTNATVPITTTPFPTSTIGVTTNATVPNT
TAPFPTNASTASTNATVPITTTCFATSTIGVTTNATVPDTTAPFPTNTTTASTNATIPIT
TTPFATSTISVTTSTTVPDTTAPFPTSTTSASTNATPVPITTTLFATSTIGVTTGTTVPD
TTAPFPTSTTSTSTSATVPITTTPSPTNTADANTSNTVPNTTMPSPTSSTTVSTIATVPI
SVTPSLTSTADATISTTVLIATTSSLTGTTDVSTSTTINNISTPVQTNTTNASTSTNVAN
ITATSHTSTDDTVPNNTVPVTAIPSLANTGVDTTSNSFSIMTTSFSESTNAMNTTVIMAT
TSPTSTDVASTNNDASMTNFLLATMSAGNITSNSISITTTSFGNSVPFVTTPSPSTDATT
TSNNTNPGMTTYYQTSPTIPTHTLTSIPSSITSILSMFPTSNTFTTDKITNFTTPTNANT
IIFNTLDTKSTMVIDATVTTTSTKDNTMSPDTTVTSIDKFTTHITQFATPHSATTTTLAL
SHTSLAPTNLSNLGTMDITDADNSSSVTGNTTHISVSNLTTASVTITATGLDSQTPHMVI
NSVATYLPITATSATTDTTNITKYALNTTTPDSTVHTSATAPTYIANAINATQVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F8VQM5	0.545	0.717	0.000	1818	0.403	0.557	F8VQM5.pdb.gz	F8VQM5_MOUSE Sucrase isomaltase (alpha-glucosidase) OS=Mus musculus OX=10090 GN=Sis PE=1 SV=1
2	AFDB:O43451	0.525	0.676	0.000	1857	0.475	0.643	O43451.pdb.gz	MGA_HUMAN Maltase-glucoamylase OS=Homo sapiens OX=9606 GN=MGAM PE=1 SV=6
3	AFDB:P23739	0.484	0.616	0.000	1841	0.386	0.528	P23739.pdb.gz	SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus OX=10116 GN=Si PE=1 SV=5
4	AFDB:Q2M2H8	1.000	1.000	0.000	2515	1.000	1.000	Q2M2H8.pdb.gz	MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens OX=9606 GN=MGAM2 PE=2 SV=3
5	PDB:5kzwA	0.327	0.958	6.705E-101	850	0.146	0.431	5kzwA.pdb.gz	The structure of human GAA: structural basis of Pompe disease
6	PDB:5iefA	0.300	0.857	2.141E-67	858	0.089	0.261	5iefA.pdb.gz	Structures of mammalian ER alpha-glucosidase II capture the binding modes of broad-spectrum iminosugar antivirals.
7	PDB:5npbA	0.276	0.851	7.852E-52	780	0.059	0.191	5npbA.pdb.gz	1,6-Cyclophellitol Cyclosulfates: A New Class of Irreversible Glycosidase Inhibitor.
8	PDB:2f2hA	0.265	0.807	1.103E-42	773	0.061	0.198	2f2hA.pdb.gz	Expanding the Thioglycoligase Strategy to the Synthesis of alpha-linked Thioglycosides Allows Structural Investigation of the Parent Enzyme/Substrate Complex
9	PDB:5jovA	0.262	0.664	5.113E-42	949	0.063	0.168	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
10	PDB:6druA	0.221	0.726	2.460E-34	718	0.052	0.181	6druA.pdb.gz	Crystal Structure of alpha-Xylosidase fromAspergillus nigerin Complex with a Hydrolyzed Xyloglucan Product and New Insights in Accurately Predicting Substrate Specificities of GH31 Family Glycosidases.
11	PDB:5aedA	0.202	0.705	6.825E-33	674	0.050	0.188	5aedA.pdb.gz	Yihq is a Sulfoquinovosidase that Cleaves Sulfoquinovosyl Diacylglyceride Sulfolipids.
12	PDB:2xn2A	0.154	0.444	3.551E-13	729	0.040	0.137	2xn2A.pdb.gz	Crystal Structure of Alpha-Galactosidase from Lactobacillus Acidophilus Ncfm: Insight Into Tetramer Formation and Substrate Binding.
13	PDB:4fnsA	0.152	0.439	7.265E-13	718	0.035	0.123	4fnsA.pdb.gz	The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
14	PDB:5m1iA	0.137	0.491	6.533E-11	539	0.025	0.117	5m1iA.pdb.gz	Structural Snapshots for Mechanism-Based Inactivation of a Glycoside Hydrolase by Cyclopropyl Carbasugars.
15	AFDB:Q9Z2I4	0.025	0.031	1.891E-1	1366	0.038	0.070	Q9Z2I4.pdb.gz	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2
16	AFDB:Q2EG98	0.019	0.021	4.063	2201	0.054	0.061	Q2EG98.pdb.gz	PK1L3_MOUSE Polycystin-1-like protein 3 OS=Mus musculus OX=10090 GN=Pkd1l3 PE=1 SV=2
17	AFDB:P12259	0.032	0.034	4.276	2224	0.056	0.063	P12259.pdb.gz	FA5_HUMAN Coagulation factor V OS=Homo sapiens OX=9606 GN=F5 PE=1 SV=4
18	AFDB:Q68CP9	0.019	0.022	5.522	1835	0.056	0.077	Q68CP9.pdb.gz	ARID2_HUMAN AT-rich interactive domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARID2 PE=1 SV=2
19	AFDB:O55005	0.034	0.042	6.116	1651	0.045	0.068	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
20	AFDB:Q5TI25	0.019	0.042	6.116	921	0.030	0.081	Q5TI25.pdb.gz	NBPFE_HUMAN Neuroblastoma breakpoint family member 14 OS=Homo sapiens OX=9606 GN=NBPF14 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0J9YVE6	0.0	1555	1200	0.297	0.623	A0A0J9YVE6_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
2	A0A0J9YVJ0	0.0	1439	986	0.268	0.683	A0A0J9YVJ0_MOUSE Maltase-glucoamylase (Fragment) OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
3	A0A571BF69	0.0	1895	3616	0.383	0.267	A0A571BF69_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
4	B5THE2	0.0	2434	1827	0.458	0.631	B5THE2_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
5	B5THE3	0.0	2142	1818	0.406	0.562	B5THE3_MOUSE Sucrase-isomaltase OS=Mus musculus OX=10090 GN=Sis PE=2 SV=1
6	F8VQM5	0.0	2139	1818	0.406	0.562	F8VQM5_MOUSE Sucrase isomaltase (alpha-glucosidase) OS=Mus musculus OX=10090 GN=Sis PE=1 SV=1
7	O43451	0.0	2024	2753	0.406	0.371	MGA_HUMAN Maltase-glucoamylase OS=Homo sapiens OX=9606 GN=MGAM PE=1 SV=6
8	P10253	0.0	633	952	0.138	0.363	LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4
9	P14410	0.0	2118	1827	0.408	0.562	SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens OX=9606 GN=SI PE=1 SV=6
10	P23739	0.0	1961	1841	0.390	0.533	SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus OX=10116 GN=Si PE=1 SV=5
11	P70699	0.0	656	953	0.146	0.384	LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus OX=10090 GN=Gaa PE=1 SV=2
12	Q2M2H8	0.0	5160	2515	1.000	1.000	MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens OX=9606 GN=MGAM2 PE=2 SV=3
13	Q6P7A9	0.0	647	953	0.140	0.368	LYAG_RAT Lysosomal alpha-glucosidase OS=Rattus norvegicus OX=10116 GN=Gaa PE=2 SV=1
14	Q6XK24	0.0	607	536	0.115	0.537	Q6XK24_MOUSE Membrane-bound maltase-glucoamylase (Fragment) OS=Mus musculus OX=10090 GN=Mgam PE=2 SV=1
15	Q21750	9.75e-166	540	955	0.131	0.346	Q21750_CAEEL P-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aagr-2 PE=1 SV=3
16	Q19004	3.38e-165	538	936	0.127	0.342	Q19004_CAEEL P-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aagr-1 PE=1 SV=2
17	Q9LYF8	1.10e-151	498	902	0.118	0.328	Q9LYF8_ARATH AT5g11720/T22P22_110 OS=Arabidopsis thaliana OX=3702 GN=AGLU1 PE=1 SV=1
18	O04931	8.39e-149	490	913	0.124	0.342	AGLU_BETVU Alpha-glucosidase OS=Beta vulgaris OX=161934 PE=1 SV=1
19	F4J6T7	1.49e-130	436	868	0.112	0.324	XYL2_ARATH Putative alpha-xylosidase 2 OS=Arabidopsis thaliana OX=3702 GN=XYL2 PE=5 SV=1
20	Q9S7Y7	5.75e-130	436	915	0.111	0.306	XYL1_ARATH Alpha-xylosidase 1 OS=Arabidopsis thaliana OX=3702 GN=XYL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17137 DUF5110	0.002	29.7	Domain of unknown function (DUF5110)
2	PF13802 Gal_mutarotas_2	1.8e-10	52.3	Galactose mutarotase-like
3	PF01055 Glyco_hydro_31	2e-292	981.5	Glycosyl hydrolases family 31
4	PF16863 NtCtMGAM_N	3.4e-54	193.3	N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
5	PF00088 Trefoil	3.1e-13	60.7	Trefoil (P-type) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008963064.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003808511.1	0.987	Amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
2	9597.XP_003810459.1	0.976	Alpha-galactosidase A
3	9597.XP_008971484.1	0.939	Glucosidase alpha, neutral C
4	9597.XP_003810369.1	0.934	Hexokinase-2 isoform X1
5	9597.XP_003815970.1	0.934	Hexokinase domain containing 1
6	9597.XP_008967166.1	0.934	Hexokinase-1 isoform X1
7	9597.XP_003828629.1	0.933	Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
8	9597.XP_003831771.1	0.933	Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
9	9597.XP_008968622.1	0.933	Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
10	9597.XP_003807453.1	0.932	1,4-alpha-glucan-branching enzyme
11	9597.XP_003807211.1	0.930	Alpha-amylase 1
12	9597.XP_003818736.1	0.930	Alpha-amylase 2B
13	9597.XP_003818738.1	0.930	Pancreatic alpha-amylase
14	9597.XP_008970301.1	0.930	Alpha-amylase 1
15	9597.XP_003826878.1	0.914	Belongs to the glycosyl hydrolase 1 family.
16	9597.XP_003818302.1	0.908	Glucosidase alpha, acid
17	9597.XP_003817749.1	0.904	Sucrase-isomaltase
18	9597.XP_003813563.1	0.900	Maltase-glucoamylase, intestinal
19	9597.XP_008956357.1	0.825	Hexokinase 3
20	9597.XP_003826661.1	0.818	Leukocyte tyrosine kinase receptor isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0090599	0.995	alpha-glucosidase activity
GO:0004558	0.991	alpha-1,4-glucosidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0009987	0.975	cellular process
GO:0044237	0.970	cellular metabolic process
GO:0005975	0.929	carbohydrate metabolic process
GO:0044262	0.786	cellular carbohydrate metabolic process
GO:1901575	0.693	organic substance catabolic process
GO:0016052	0.585	carbohydrate catabolic process
GO:0044275	0.419	cellular carbohydrate catabolic process
GO:0009311	0.356	oligosaccharide metabolic process
GO:0005976	0.333	polysaccharide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.995	membrane
GO:0043226	0.976	organelle
GO:0012505	0.973	endomembrane system
GO:0043227	0.971	membrane-bounded organelle
GO:0005737	0.971	cytoplasm
GO:0043229	0.971	intracellular organelle
GO:0005576	0.960	extracellular region
GO:0043231	0.936	intracellular membrane-bounded organelle
GO:0031982	0.924	vesicle
GO:0070062	0.900	extracellular exosome
GO:0071944	0.719	cell periphery
GO:0005886	0.699	plasma membrane
GO:0005903	0.378	brush border
GO:0070013	0.359	intracellular organelle lumen
GO:0030141	0.333	secretory granule
GO:0031090	0.330	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.20	0.995	alpha-glucosidase.

[back to server]