StarFunc result for job id Q2M2I5

User Input

>input (525 residues)
MSCSSRASSSRAGGSSSARVSAGGSSFSSGSRCGLGGSSAQGFRGGASSCSLSGGSSGAF
GGSFGGGFGSCSVGGGFGGASGSGTGFGGGSSFGGVSGFGRGSGFCGSSRFSSGATGGFY
SYGGGMGGGVGDGGLFSGGEKQTMQNLNDRLANYLDKVRALEEANTDLENKIKEWYDKYG
PGSGDGGSGRDYSKYYSIIEDLRNQIIAATVENAGIILHIDNARLAADDFRLKYENELCL
RQSVEADINGLRKVLDDLTMTRSDLEMQIESFTEELAYLRKNHEEEMKNMQGSSGGEVTV
EMNAAPGTDLTKLLNDMRAQYEELAEQNRREAEERFNKQSASLQAQISTDAGAATSAKNE
ITELKRTLQALEIELQSQLAMKSSLEGTLADTEAGYVAQLSEIQTQISALEEEICQIWGE
TKCQNAEYKQLLDIKTRLEVEIETYRRLLDGEGGGSSFAEFGGRNSGSVNMGSRDLVSGD
SRSGSCSGQGRDSSKTRVTKTIVEELVDGKVVSSQVSSISEVKVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2M2I5	1.000	1.000	6.765E-69	525	1.000	1.000	Q2M2I5.pdb.gz	K1C24_HUMAN Keratin, type I cytoskeletal 24 OS=Homo sapiens OX=9606 GN=KRT24 PE=1 SV=1
2	AFDB:Q6IFX1	0.439	0.464	4.268E-42	491	0.674	0.721	Q6IFX1.pdb.gz	K1C24_RAT Keratin, type I cytoskeletal 24 OS=Rattus norvegicus OX=10116 GN=Krt24 PE=3 SV=1
3	AFDB:Q7Z3Y7	0.419	0.466	1.275E-29	464	0.507	0.573	Q7Z3Y7.pdb.gz	K1C28_HUMAN Keratin, type I cytoskeletal 28 OS=Homo sapiens OX=9606 GN=KRT28 PE=1 SV=2
4	AFDB:Q99456	0.447	0.469	1.460E-29	494	0.520	0.553	Q99456.pdb.gz	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
5	AFDB:Q7Z3Y8	0.363	0.409	3.514E-29	459	0.516	0.590	Q7Z3Y8.pdb.gz	K1C27_HUMAN Keratin, type I cytoskeletal 27 OS=Homo sapiens OX=9606 GN=KRT27 PE=1 SV=2
6	AFDB:Q64291	0.352	0.377	6.457E-29	487	0.509	0.548	Q64291.pdb.gz	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
7	AFDB:Q6IFV1	0.335	0.360	3.270E-28	485	0.495	0.536	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
8	AFDB:Q6PVZ1	0.395	0.439	4.265E-27	467	0.486	0.546	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
9	AFDB:P02533	0.355	0.390	1.027E-26	472	0.486	0.540	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
10	AFDB:Q6IFU8	0.416	0.494	5.200E-26	433	0.478	0.580	Q6IFU8.pdb.gz	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
11	PDB:2ymwB	0.050	0.039	2.399	685	0.019	0.015	2ymwB.pdb.gz
12	PDB:6u424R	0.182	0.253	2.939	366	0.103	0.148	6u424R.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.
13	PDB:1ddtA	0.040	0.040	4.120	523	0.011	0.011	1ddtA.pdb.gz	Refined structure of dimeric diphtheria toxin at 2.0 A resolution.
14	PDB:5tthA	0.032	0.027	4.409	671	0.013	0.010	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
15	PDB:5n9jE	0.093	0.225	6.181	201	0.025	0.065	5n9jE.pdb.gz
16	PDB:8at3A	0.105	0.164	6.181	286	0.091	0.168	8at3A.pdb.gz
17	PDB:7mscq	0.038	0.158	7.076	95	0.011	0.063	7mscq.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
18	PDB:3m3rC	0.035	0.059	8.100	293	0.013	0.024	3m3rC.pdb.gz
19	PDB:3gzuJ	0.034	0.044	8.666	397	0.008	0.010	3gzuJ.pdb.gz	Molecular interactions in rotavirus assembly and uncoating seen by high-resolution cryo-EM.
20	PDB:3fsyD	0.036	0.053	9.272	308	0.006	0.010	3fsyD.pdb.gz	The three-dimensional Structure of a mycobacterial DapD provides insights into DapD diversity and reveals unexpected particulars about the enzymatic mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2M2I5	0.0	1040	525	1.000	1.000	K1C24_HUMAN Keratin, type I cytoskeletal 24 OS=Homo sapiens OX=9606 GN=KRT24 PE=1 SV=1
2	Q9Z320	4.53e-161	467	448	0.457	0.536	K1C27_MOUSE Keratin, type I cytoskeletal 27 OS=Mus musculus OX=10090 GN=Krt27 PE=1 SV=1
3	Q7Z3Y8	3.09e-160	465	459	0.457	0.523	K1C27_HUMAN Keratin, type I cytoskeletal 27 OS=Homo sapiens OX=9606 GN=KRT27 PE=1 SV=2
4	Q99456	1.43e-159	465	494	0.440	0.468	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
5	Q64291	2.07e-156	456	487	0.434	0.468	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
6	Q7Z3Z0	1.35e-155	453	450	0.476	0.556	K1C25_HUMAN Keratin, type I cytoskeletal 25 OS=Homo sapiens OX=9606 GN=KRT25 PE=1 SV=1
7	Q7Z3Y7	1.28e-154	451	464	0.507	0.573	K1C28_HUMAN Keratin, type I cytoskeletal 28 OS=Homo sapiens OX=9606 GN=KRT28 PE=1 SV=2
8	Q8VCW2	1.69e-154	450	446	0.463	0.545	K1C25_MOUSE Keratin, type I cytoskeletal 25 OS=Mus musculus OX=10090 GN=Krt25 PE=1 SV=1
9	P13645	6.25e-151	446	584	0.411	0.370	K1C10_HUMAN Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6
10	Q7Z3Y9	2.60e-149	437	468	0.474	0.532	K1C26_HUMAN Keratin, type I cytoskeletal 26 OS=Homo sapiens OX=9606 GN=KRT26 PE=1 SV=2
11	P02535	1.19e-148	439	570	0.404	0.372	K1C10_MOUSE Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3
12	Q9QWL7	1.67e-146	429	433	0.444	0.538	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
13	Q6IFU8	4.90e-146	428	433	0.451	0.547	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
14	Q04695	2.45e-143	421	432	0.406	0.493	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
15	P13646	9.41e-141	416	458	0.389	0.445	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4
16	K7ERE3	1.23e-140	414	415	0.389	0.492	K7ERE3_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
17	A1A4E9	4.74e-140	414	458	0.387	0.443	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
18	Q6IFV4	7.63e-140	412	438	0.387	0.463	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
19	P08730	6.84e-139	410	437	0.392	0.471	K1C13_MOUSE Keratin, type I cytoskeletal 13 OS=Mus musculus OX=10090 GN=Krt13 PE=1 SV=2
20	Q6PVZ1	1.68e-136	405	467	0.491	0.552	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17675 APG6_N	2.4e+02	13.6	Apg6 coiled-coil region
2	PF14362 DUF4407	1.2	20.0	Domain of unknown function (DUF4407)
3	PF14988 DUF4515	1.7e+02	13.6	Domain of unknown function (DUF4515)
4	PF00038 Filament	2.3e-103	357.7	Intermediate filament protein
5	PF14282 FlxA	38	15.8	FlxA-like protein
6	PF13851 GAS	1.8e+02	12.9	Growth-arrest specific micro-tubule binding
7	PF01763 Herpes_UL6	2.4e+02	11.6	Herpesvirus UL6 like
8	PF14389 Lzipper-MIP1	5.7e+02	12.3	Leucine-zipper of ternary complex factor MIP1
9	PF18595 Nuf2_DHR10-like	2.9e+02	12.9	Nuf2, DHR10-like domain
10	PF05478 Prominin	4.2e+02	10.4	Prominin
11	PF09728 Taxilin	1.5e+02	13.0	Myosin-like coiled-coil protein
12	PF07926 TPR_MLP1_2	5.5	18.4	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264651

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321684	0.815	Homeobox protein MOX-1
2	9606.ENSP00000007735	0.550	Keratin, type I cuticular Ha3-I
3	9606.ENSP00000251645	0.535	Keratin, type I cuticular Ha1
4	9606.ENSP00000251646	0.533	Keratin, type I cuticular Ha3-II
5	9606.ENSP00000225899	0.529	Keratin, type I cuticular Ha2
6	9606.ENSP00000310573	0.527	Keratin, type I cytoskeletal 25
7	9606.ENSP00000366984	0.525	Keratin, type I cytoskeletal 40
8	9606.ENSP00000301656	0.523	Keratin, type I cytoskeletal 27
9	9606.ENSP00000347823	0.520	Keratin, type I cytoskeletal 39
10	9606.ENSP00000246646	0.519	Keratin, type I cuticular Ha8
11	9606.ENSP00000225550	0.518	Keratin, type I cuticular Ha7
12	9606.ENSP00000334798	0.517	Keratin, type I cytoskeletal 26
13	9606.ENSP00000377570	0.514	Keratin, type I cuticular Ha4
14	9606.ENSP00000305263	0.509	Keratin, type I cytoskeletal 28
15	9606.ENSP00000329165	0.505	Keratin, type I cuticular Ha6
16	9606.ENSP00000377558	0.505	Keratin, type I cuticular Ha5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.739	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.996	developmental process
GO:0048856	0.914	anatomical structure development
GO:0009987	0.888	cellular process
GO:0032501	0.529	multicellular organismal process
GO:0009888	0.432	tissue development
GO:0071840	0.382	cellular component organization or biogenesis
GO:0016043	0.301	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005615	0.998	extracellular space
GO:0005829	0.997	cytosol
GO:0005856	0.996	cytoskeleton
GO:0070062	0.989	extracellular exosome
GO:0099080	0.984	supramolecular complex
GO:0045111	0.975	intermediate filament cytoskeleton
GO:0005882	0.959	intermediate filament
GO:0043231	0.822	intracellular membrane-bounded organelle
GO:0005634	0.697	nucleus
GO:0045095	0.374	keratin filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]