StarFunc result for job id Q2M2I8

User Input

>input (961 residues)
MKKFFDSRREQGGSGLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIV
FLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVW
EVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVE
NILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIIT
TKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDK
RPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPTT
ETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPPPQAAGSSNQPGLLASVPQPKP
QAPPSQPLPQTQAKQPQAPPTPQQTPSTQAQGLPAQAQATPQHQQQLFLKQQQQQQQPPP
AQQQPAGTFYQQQQAQTQQFQAVHPATQKPAIAQFPVVSQGGSQQQLMQNFYQQQQQQQQ
QQQQQQLATALHQQQLMTQQAALQQKPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPVRQQ
PKVQTTPPPAVQGQKVGSLTPPSSPKTQRAGHRRILSDVTHSAVFGVPASKSTQLLQAAA
AEASLNKSKSATTTPSGSPRTSQQNVYNPSEGSTWNPFDDDNFSKLTAEELLNKDFAKLG
EGKHPEKLGGSAESLIPGFQSTQGDAFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFI
PLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIEKADVAVESLIPGLEPPV
PQRLPSQTESVTSNRTDSLTGEDSLLDCSLLSNPTTDLLEEFAPTAISAPVHKAAEDSNL
ISGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARSLLLVDQLID
L

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1SPM8	0.467	0.464	0.000	968	0.935	0.929	F1SPM8.pdb.gz	AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa OX=9823 GN=AAK1 PE=2 SV=2
2	AFDB:P0C1X8	0.599	0.598	0.000	962	0.908	0.907	P0C1X8.pdb.gz	AAK1_RAT AP2-associated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Aak1 PE=1 SV=1
3	AFDB:Q91Z96	0.363	0.311	1.269E-58	1138	0.384	0.324	Q91Z96.pdb.gz	BMP2K_MOUSE BMP-2-inducible protein kinase OS=Mus musculus OX=10090 GN=Bmp2k PE=1 SV=1
4	PDB:2bujA	0.269	0.842	1.497E-21	291	0.086	0.285	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
5	AFDB:Q9TW45	0.248	0.202	2.205E-20	1192	0.179	0.144	Q9TW45.pdb.gz	PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans OX=6239 GN=par-1 PE=1 SV=1
6	AFDB:Q9W179	0.250	0.145	6.069E-19	1703	0.172	0.097	Q9W179.pdb.gz	Q9W179_DROME Sterile20-like kinase, isoform B OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=2
7	AFDB:Q9W532	0.249	0.175	1.765E-18	1398	0.191	0.132	Q9W532.pdb.gz	Q9W532_DROME FI24002p1 OS=Drosophila melanogaster OX=7227 GN=Sik2 PE=2 SV=1
8	AFDB:M9PBJ7	0.254	0.203	5.430E-18	1213	0.181	0.143	M9PBJ7.pdb.gz	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
9	PDB:5u6yA	0.237	0.479	4.896E-17	459	0.085	0.179	5u6yA.pdb.gz
10	PDB:7myjC	0.240	0.474	2.361E-16	465	0.089	0.185	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
11	AFDB:Q6P4S6	0.247	0.184	2.774E-16	1311	0.197	0.144	Q6P4S6.pdb.gz	SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus OX=10090 GN=Sik3 PE=1 SV=4
12	AFDB:P38692	0.236	0.211	3.283E-16	1080	0.175	0.156	P38692.pdb.gz	KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KIC1 PE=1 SV=1
13	AFDB:A0A0R4IEP9	0.242	0.178	3.886E-16	1332	0.162	0.117	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
14	PDB:3c4wB	0.230	0.407	1.508E-15	519	0.069	0.127	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
15	PDB:4d28C	0.220	0.699	1.595E-15	279	0.087	0.301	4d28C.pdb.gz
16	PDB:5ufuA	0.240	0.589	1.595E-15	369	0.071	0.184	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
17	PDB:3nynA	0.233	0.393	2.364E-15	554	0.069	0.119	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
18	PDB:4eomC	0.231	0.745	2.364E-15	276	0.074	0.257	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
19	PDB:4zhxA	0.239	0.535	4.147E-15	409	0.074	0.174	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:6s73A	0.232	0.781	4.908E-15	269	0.067	0.238	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1MH24	0.0	1558	957	0.944	0.948	AAK1_BOVIN AP2-associated protein kinase 1 OS=Bos taurus OX=9913 GN=AAK1 PE=1 SV=2
2	F1SPM8	0.0	1596	968	0.937	0.930	AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa OX=9823 GN=AAK1 PE=2 SV=2
3	P0C1X8	0.0	1495	962	0.900	0.899	AAK1_RAT AP2-associated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Aak1 PE=1 SV=1
4	Q2M2I8	0.0	1948	961	1.000	1.000	AAK1_HUMAN AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1 PE=1 SV=3
5	Q3UHJ0	0.0	1504	959	0.903	0.905	AAK1_MOUSE AP2-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Aak1 PE=1 SV=2
6	Q91Z96	0.0	591	1138	0.276	0.233	BMP2K_MOUSE BMP-2-inducible protein kinase OS=Mus musculus OX=10090 GN=Bmp2k PE=1 SV=1
7	Q9NSY1	0.0	596	1161	0.281	0.233	BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens OX=9606 GN=BMP2K PE=1 SV=2
8	Q7KT38	6.28e-137	428	698	0.225	0.309	Q7KT38_DROME Numb-associated kinase, isoform C OS=Drosophila melanogaster OX=7227 GN=Nak PE=1 SV=1
9	X2J946	9.52e-137	428	708	0.225	0.305	X2J946_DROME Numb-associated kinase, isoform E OS=Drosophila melanogaster OX=7227 GN=Nak PE=1 SV=1
10	Q8MSQ7	2.35e-135	424	698	0.226	0.311	Q8MSQ7_DROME SD07306p OS=Drosophila melanogaster OX=7227 GN=Nak PE=2 SV=1
11	Q9U485	2.13e-130	430	1490	0.225	0.145	Q9U485_DROME Numb-associated kinase OS=Drosophila melanogaster OX=7227 GN=Nak PE=2 SV=1
12	Q9VJ30	2.39e-130	430	1488	0.225	0.145	Q9VJ30_DROME Numb-associated kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Nak PE=1 SV=2
13	Q9USS2	4.27e-66	241	872	0.129	0.142	PPK29_SCHPO Serine/threonine-protein kinase ppk29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk29 PE=1 SV=1
14	O43066	1.63e-65	240	953	0.123	0.124	PPK30_SCHPO Serine/threonine-protein kinase ppk30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk30 PE=1 SV=1
15	P40494	3.74e-60	223	810	0.117	0.138	PRK1_YEAST Actin-regulating kinase PRK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRK1 PE=1 SV=1
16	P53974	8.02e-58	213	638	0.118	0.177	ARK1_YEAST Actin-regulating kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARK1 PE=1 SV=1
17	Q9UU85	1.88e-56	209	650	0.125	0.185	PPK38_SCHPO Protein kinase domain-containing protein ppk38 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk38 PE=4 SV=1
18	P38080	2.19e-53	205	1108	0.118	0.102	AKL1_YEAST Serine/threonine-protein kinase AKL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AKL1 PE=1 SV=1
19	O14976	5.65e-53	204	1311	0.120	0.088	GAK_HUMAN Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK PE=1 SV=2
20	P97874	1.16e-52	203	1305	0.122	0.090	GAK_RAT Cyclin-G-associated kinase OS=Rattus norvegicus OX=10116 GN=Gak PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	97	13.5	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	3.8e+02	11.4	Haspin like kinase domain
3	PF06293 Kdo	46	14.8	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	0.0018	29.3	Kinase-like
5	PF00069 Pkinase	1.5e-39	147.5	Protein kinase domain
6	PF17667 Pkinase_fungal	7.6	16.8	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	6.3e-23	92.9	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386456

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292807	0.980	AP-2 complex subunit mu
2	9606.ENSP00000392065	0.966	RalBP1-associated Eps domain-containing protein 1
3	9606.ENSP00000360798	0.954	Epidermal growth factor receptor substrate 15
4	9606.ENSP00000263270	0.935	AP-2 complex subunit sigma
5	9606.ENSP00000298316	0.929	ADP-ribosylation factor 6
6	9606.ENSP00000345195	0.912	Ubiquilin-2
7	9606.ENSP00000314615	0.904	ADP-ribosylation factor GTPase-activating protein 1
8	9606.ENSP00000351926	0.888	AP-2 complex subunit alpha-1
9	9606.ENSP00000327694	0.873	AP-2 complex subunit alpha-2
10	9606.ENSP00000482835	0.856	AP-2 complex subunit beta
11	9606.ENSP00000473001	0.855	F-BAR domain only protein 1
12	9606.ENSP00000360076	0.848	SH3-containing GRB2-like protein 3-interacting protein 1
13	9606.ENSP00000309415	0.845	Clathrin light chain B
14	9606.ENSP00000451300	0.844	Protein numb homolog
15	9606.ENSP00000479606	0.842	Clathrin heavy chain 1
16	9606.ENSP00000341737	0.823	Adaptin ear-binding coat-associated protein 1
17	9606.ENSP00000406209	0.795	Epsin-1
18	9606.ENSP00000370719	0.790	Intersectin-1
19	9606.ENSP00000252891	0.782	Numb-like protein
20	9606.ENSP00000393776	0.778	F-BAR domain only protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.999	protein-containing complex binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.993	regulation of cellular process
GO:2000369	0.980	regulation of clathrin-dependent endocytosis
GO:0008152	0.970	metabolic process
GO:0071704	0.963	organic substance metabolic process
GO:0044237	0.953	cellular metabolic process
GO:0006793	0.933	phosphorus metabolic process
GO:0043412	0.927	macromolecule modification
GO:0044238	0.895	primary metabolic process
GO:0006897	0.885	endocytosis
GO:0006807	0.839	nitrogen compound metabolic process
GO:0016310	0.803	phosphorylation
GO:0051649	0.795	establishment of localization in cell
GO:0006468	0.774	protein phosphorylation
GO:0140238	0.621	presynaptic endocytosis
GO:0048518	0.436	positive regulation of biological process
GO:0048522	0.422	positive regulation of cellular process
GO:0071840	0.392	cellular component organization or biogenesis
GO:0016043	0.368	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane
GO:0005829	0.995	cytosol
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0031410	0.948	cytoplasmic vesicle
GO:0030135	0.922	coated vesicle
GO:0032991	0.895	protein-containing complex
GO:0030136	0.857	clathrin-coated vesicle
GO:0012505	0.497	endomembrane system
GO:0042995	0.327	cell projection
GO:0005634	0.325	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]