StarFunc result for job id Q2M385

User Input

>input (716 residues)
MNNFRATILFWAAAAWAKSGKPSGEMDEVGVQKCKNALKLPVLEVLPGGGWDNLRNVDMG
RVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELS
LFSKVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISD
RLENNQTRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASA
GLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHL
VAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNF
QANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVH
LLSQIHEEGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFG
GLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPL
VDPAISRDLGAPSLKKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPFTRPP
LMSQAATNTVIVTNSENARSWIKDSQTHQWRLGEPIELRRAMNVIHGDGGGLSGGAAAGV
TVGVTTILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1L314	0.871	0.874	0.000	713	0.749	0.752	A1L314.pdb.gz	MPEG1_MOUSE Macrophage-expressed gene 1 protein OS=Mus musculus OX=10090 GN=Mpeg1 PE=1 SV=1
2	AFDB:Q2M385	1.000	1.000	0.000	716	1.000	1.000	Q2M385.pdb.gz	MPEG1_HUMAN Macrophage-expressed gene 1 protein OS=Homo sapiens OX=9606 GN=MPEG1 PE=1 SV=1
3	PDB:6u2lA	0.775	0.903	1.209E-100	613	0.837	0.977	6u2lA.pdb.gz
4	PDB:6u23A	0.799	0.979	1.723E-98	583	0.813	0.998	6u23A.pdb.gz
5	PDB:6sb3A	0.805	0.950	1.104E-88	604	0.676	0.801	6sb3A.pdb.gz
6	AFDB:B0R0K7	0.844	0.841	5.020E-88	718	0.487	0.486	B0R0K7.pdb.gz
7	AFDB:A9C3Q1	0.809	0.813	7.979E-83	713	0.462	0.464	A9C3Q1.pdb.gz	A9C3Q1_DANRE Macrophage-expressed gene 1 protein OS=Danio rerio OX=7955 GN=DKEY-150D12.4 PE=3 SV=1
8	PDB:8a1dA	0.318	0.421	1.008E-62	533	0.538	0.722	8a1dA.pdb.gz	Cryo-EM structures of perforin-2 in isolation and assembled on a membrane suggest a mechanism for pore formation.
9	AFDB:Q9U0J9	0.331	0.287	1.321E-16	842	0.127	0.108	Q9U0J9.pdb.gz	Q9U0J9_PLAF7 Perforin-like protein 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0408700 PE=4 SV=1
10	AFDB:Q8I5P0	0.276	0.191	7.176E-13	1073	0.106	0.071	Q8I5P0.pdb.gz	Q8I5P0_PLAF7 Perforin-like protein 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1216700 PE=4 SV=1
11	AFDB:P13671	0.352	0.276	1.425E-12	934	0.126	0.096	P13671.pdb.gz	CO6_HUMAN Complement component C6 OS=Homo sapiens OX=9606 GN=C6 PE=1 SV=3
12	AFDB:P14222	0.326	0.408	2.291E-12	555	0.117	0.151	P14222.pdb.gz	PERF_HUMAN Perforin-1 OS=Homo sapiens OX=9606 GN=PRF1 PE=1 SV=1
13	AFDB:P35763	0.295	0.366	2.684E-12	554	0.101	0.130	P35763.pdb.gz	PERF_RAT Perforin-1 OS=Rattus norvegicus OX=10116 GN=Prf1 PE=2 SV=1
14	AFDB:P10820	0.320	0.403	3.683E-12	554	0.113	0.146	P10820.pdb.gz	PERF_MOUSE Perforin-1 OS=Mus musculus OX=10090 GN=Prf1 PE=1 SV=2
15	PDB:3nsjA	0.300	0.391	4.621E-12	530	0.102	0.138	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
16	PDB:3t5oA	0.338	0.283	6.130E-11	871	0.110	0.091	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
17	PDB:4e0sB	0.326	0.266	4.551E-10	898	0.082	0.066	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
18	PDB:3ojyB	0.293	0.400	9.209E-9	504	0.082	0.117	3ojyB.pdb.gz	Structure of human C8 protein provides mechanistic insight into membrane pore formation by complement.
19	PDB:4a5wB	0.292	0.244	2.788E-8	871	0.074	0.061	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
20	PDB:7nydE	0.214	0.306	2.896E-6	484	0.068	0.101	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L314	0.0	1160	713	0.757	0.760	MPEG1_MOUSE Macrophage-expressed gene 1 protein OS=Mus musculus OX=10090 GN=Mpeg1 PE=1 SV=1
2	A9C3Q1	0.0	659	713	0.468	0.470	A9C3Q1_DANRE Macrophage-expressed gene 1 protein OS=Danio rerio OX=7955 GN=DKEY-150D12.4 PE=3 SV=1
3	Q2M385	0.0	1492	716	1.000	1.000	MPEG1_HUMAN Macrophage-expressed gene 1 protein OS=Homo sapiens OX=9606 GN=MPEG1 PE=1 SV=1
4	Q503Q0	0.0	654	713	0.465	0.467	Q503Q0_DANRE Macrophage-expressed gene 1 protein OS=Danio rerio OX=7955 GN=mpeg1.2 PE=2 SV=1
5	Q7SXE0	0.0	708	718	0.487	0.486	Q7SXE0_DANRE Macrophage-expressed gene 1 protein OS=Danio rerio OX=7955 GN=mpeg1 PE=2 SV=1
6	Q0WWT7	0.036	39.3	292	0.034	0.082	STR11_ARATH Rhodanese-like domain-containing protein 11, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=STR11 PE=2 SV=1
7	Q9LVZ5	0.25	36.6	268	0.021	0.056	PIFI_ARATH Protein POST-ILLUMINATION CHLOROPHYLL FLUORESCENCE INCREASE, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PIFI PE=2 SV=1
8	P31809	0.41	36.2	521	0.029	0.040	CEAM1_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ceacam1 PE=1 SV=1
9	Q3LFS9	0.53	35.8	341	0.029	0.062	Q3LFS9_MOUSE CEA cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ceacam1 PE=1 SV=2
10	Q10056	6.4	32.3	589	0.054	0.066	SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=shk2 PE=3 SV=1
11	Q9SJU9	6.8	32.3	347	0.052	0.107	GC1_ARATH Epimerase family protein SDR39U1 homolog, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GC1 PE=2 SV=2
12	P35763	7.7	32.3	554	0.057	0.074	PERF_RAT Perforin-1 OS=Rattus norvegicus OX=10116 GN=Prf1 PE=2 SV=1
13	O07227	7.8	29.6	73	0.022	0.219	VAPB2_MYCTU Antitoxin VapB2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=vapB2 PE=1 SV=1
14	Q16342	8.2	32.0	344	0.027	0.055	PDCD2_HUMAN Programmed cell death protein 2 OS=Homo sapiens OX=9606 GN=PDCD2 PE=1 SV=2
15	O70534	9.7	31.6	383	0.060	0.112	DLK1_RAT Protein delta homolog 1 OS=Rattus norvegicus OX=10116 GN=Dlk1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01823 MACPF	4.8e-29	113.5	MAC/Perforin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354335

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227163	0.831	Transcription factor PU.1
2	9606.ENSP00000357981	0.811	Cathepsin S
3	9606.ENSP00000286301	0.803	Macrophage colony-stimulating factor 1 receptor
4	9606.ENSP00000398568	0.761	Perforin-1
5	9606.ENSP00000313967	0.756	Complement C1q subcomponent subunit B
6	9606.ENSP00000320563	0.740	WD repeat- and FYVE domain-containing protein 4
7	9606.ENSP00000381581	0.715	Plastin-2
8	9606.ENSP00000318916	0.703	Macrophage receptor MARCO
9	9606.ENSP00000362195	0.683	Granulocyte colony-stimulating factor receptor
10	9606.ENSP00000411355	0.683	Receptor-type tyrosine-protein phosphatase C
11	9606.ENSP00000380948	0.682	Integrin beta-2
12	9606.ENSP00000234313	0.674	Pleckstrin
13	9606.ENSP00000268638	0.670	Interferon regulatory factor 8
14	9606.ENSP00000363773	0.661	Complement C1q subcomponent subunit A
15	9606.ENSP00000302079	0.657	C3a anaphylatoxin chemotactic receptor
16	9606.ENSP00000384053	0.647	Cytokine receptor common subunit beta
17	9606.ENSP00000363770	0.646	Complement C1q subcomponent subunit C
18	9606.ENSP00000046794	0.639	Lymphocyte cytosolic protein 2
19	9606.ENSP00000427114	0.619	FYN-binding protein 1
20	9606.ENSP00000356430	0.618	Regulator of G-protein signaling 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005215	0.788	transporter activity
GO:0015267	0.777	channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0006952	0.862	defense response
GO:0009605	0.855	response to external stimulus
GO:0009607	0.759	response to biotic stimulus
GO:0044419	0.711	biological process involved in interspecies interaction between organisms
GO:0098542	0.703	defense response to other organism
GO:0050830	0.600	defense response to Gram-positive bacterium
GO:0050829	0.557	defense response to Gram-negative bacterium
GO:0002376	0.539	immune system process
GO:0006955	0.341	immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031410	1.000	cytoplasmic vesicle
GO:0071944	0.556	cell periphery
GO:0005886	0.547	plasma membrane
GO:0012505	0.449	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]